SimulationCraft 902-01

for World of Warcraft 9.0.2.36599 Live (wow build level 36599)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Kyrian_Forgelite : 9354 dps, 5101 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9353.6 9353.6 16.5 / 0.176% 792.3 / 8.5% 19.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
407.9 404.9 Mana 0.00% 38.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Forgelite 9354
Cataclysm 775 8.3% 9.7 32.33sec 23963 14102 Direct 29.2 6700 13406 7986 19.2%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.73 29.18 0.00 0.00 1.6994 0.0000 233060.91 233060.91 0.00% 14101.83 14101.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 23.58 14 32 6700.36 6141 7261 6700.06 6518 6902 157962 157962 0.00%
crit 19.20% 5.60 1 12 13405.74 12284 14519 13415.57 12527 14370 75099 75099 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.81
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1001) 0.0% (10.7%) 12.0 25.65sec 25058 9246

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.02 0.00 179.53 0.00 2.7101 0.1645 0.00 0.00 0.00% 9246.25 9246.25

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.02
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1001 10.7% 0.0 0.00sec 0 0 Direct 538.6 469 937 559 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 538.59 0.00 0.00 0.0000 0.0000 301094.94 301094.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 434.77 299 560 468.79 263 976 468.86 443 501 203801 203801 0.00%
crit 19.28% 103.82 63 148 937.06 525 1952 937.20 820 1065 97294 97294 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1126 (1495) 12.0% (16.0%) 18.8 15.55sec 23885 12019 Direct 37.4 (73.8) 0 9034 9034 100.0% (60.1%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.78 37.41 0.00 0.00 1.9874 0.0000 337962.92 337962.92 0.00% 12018.59 12018.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.41 26 50 9033.75 5863 12241 9034.15 8811 9296 337963 337963 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.87
  • if_expr:cast_time<havoc_remains
    Internal Combustion 369 3.9% 36.4 15.65sec 3042 0 Direct 36.4 2565 5063 3040 19.1%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.37 36.37 0.00 0.00 0.0000 0.0000 110630.92 110630.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.91% 29.43 17 45 2564.93 1 3715 2569.32 2277 2785 75524 75524 0.00%
crit 19.09% 6.94 1 16 5062.93 12 7428 5062.50 1349 6647 35107 35107 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 792 8.5% 37.0 7.96sec 6436 5150 Direct 55.1 3622 7264 4323 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.00 55.06 0.00 0.00 1.2497 0.0000 238110.84 238110.84 0.00% 5149.90 5149.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 44.45 29 59 3622.10 2047 5042 3622.39 3377 3860 160983 160983 0.00%
crit 19.27% 10.61 3 19 7263.98 4096 10084 7261.75 5159 9078 77128 77128 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.92
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.07
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1590 17.0% 25.5 11.39sec 18761 14897 Direct 31.9 1515 3029 1806 19.2%
Periodic 348.0 1014 2029 1209 19.2% 95.7%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.50 31.87 347.97 347.97 1.2594 2.4830 478358.44 478358.44 0.00% 533.81 14896.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 25.74 15 36 1514.93 819 2017 1514.38 1393 1637 38984 38984 0.00%
crit 19.25% 6.13 0 16 3028.97 1641 4033 3003.12 0 3663 18579 18579 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.78% 281.10 214 353 1014.31 0 1261 1014.39 993 1034 285105 285105 0.00%
crit 19.22% 66.87 36 102 2028.86 1 2521 2029.11 1919 2134 135690 135690 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.68
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.88
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 554 5.9% 39.6 7.10sec 4217 2993 Direct 50.4 (50.4) 2780 5560 3310 19.1% (19.1%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.59 50.41 0.00 0.00 1.4090 0.0000 166956.54 166956.54 0.00% 2992.70 2992.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 40.77 21 60 2780.32 1315 3426 2781.19 2589 3006 113312 113312 0.00%
crit 19.13% 9.65 2 21 5560.19 2670 6852 5565.51 4121 6561 53645 53645 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:28.64
    havoc
    [S]:11.15
  • if_expr:cast_time<havoc_remains
Rain of Fire 965 10.3% 18.5 15.74sec 15648 12601 Periodic 440.1 553 1106 659 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.55 0.00 0.00 440.08 1.2418 0.0000 290190.97 290190.97 0.00% 12601.11 12601.11
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.74% 355.33 237 488 552.89 507 599 552.87 545 561 196457 196457 0.00%
crit 19.26% 84.75 48 132 1105.87 1013 1198 1105.88 1082 1126 93734 93734 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.45
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:12.08
Scouring Tithe 329 3.5% 13.5 22.66sec 7355 4375 Direct 18.8 1483 2966 1763 18.8%
Periodic 133.6 413 826 493 19.3% 36.3%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.46 18.81 133.59 133.59 1.6811 2.4567 98992.58 98992.58 0.00% 282.18 4375.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.15% 15.27 8 22 1483.44 1004 1674 1484.57 1365 1626 22648 22648 0.00%
crit 18.85% 3.55 0 11 2966.33 2009 3348 2907.39 0 3348 10521 10521 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.73% 107.85 76 150 413.14 123 419 413.13 410 416 44558 44558 0.00%
crit 19.27% 25.74 11 44 826.19 246 837 826.14 787 837 21266 21266 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:6.79
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.74
Soul Fire 480 5.1% 5.6 49.41sec 25949 7462 Direct 7.4 16242 32582 19506 20.1%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.57 7.40 0.00 0.00 3.4775 0.0000 144435.42 144435.42 0.00% 7462.05 7462.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.95% 5.91 1 10 16241.78 8604 21175 16313.71 13390 19693 96107 96107 0.00%
crit 20.05% 1.48 0 7 32581.92 17291 42349 26891.41 0 42284 48328 48328 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.79
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.88
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.9% 2.0 180.78sec 11977 10357 Direct 6.0 3348 6696 3988 19.2%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23954.92 23954.92 0.00% 10356.64 10356.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 4.85 1 6 3348.13 3348 3348 3348.13 3348 3348 16223 16223 0.00%
crit 19.25% 1.15 0 5 6696.27 6696 6696 4816.62 0 6696 7732 7732 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3818 / 772
Immolation 3552 7.6% 39.0 5.50sec 5464 0 Direct 117.0 1529 3059 1821 19.1%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213112.98 213112.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.89% 94.64 81 106 1529.08 1395 2023 1529.17 1494 1553 144719 144719 0.00%
crit 19.11% 22.36 11 36 3059.34 2790 4046 3057.37 2796 3334 68394 68394 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 267 0.6% 41.0 5.26sec 390 272 Direct 41.0 326 651 390 19.8%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15995.67 22848.22 29.99% 271.55 271.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.16% 32.87 23 40 325.55 326 326 325.55 326 326 10700 15283 29.99%
crit 19.84% 8.13 1 18 651.10 651 651 651.10 651 651 5296 7565 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.5% 93.6 3.21sec 1653 1135 Direct 92.9 1395 2790 1665 19.4%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.58 92.89 0.00 0.00 1.4562 0.0000 154679.92 154679.92 0.00% 1135.07 1135.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 74.91 53 99 1395.06 1395 1395 1395.06 1395 1395 104502 104502 0.00%
crit 19.36% 17.98 7 33 2790.11 2790 2790 2790.11 2790 2790 50178 50178 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:94.02
pet - bron 61 / 6
melee 61 0.1% 9.0 2.88sec 205 157 Direct 9.0 172 343 204 19.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.3020 0.0000 1841.06 2629.77 29.99% 157.11 157.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.86% 7.28 3 9 171.70 172 172 171.70 172 172 1250 1785 29.99%
crit 19.14% 1.72 0 6 343.40 343 343 294.11 0 343 592 845 25.69%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
Kyrian_Forgelite
Havoc 9.7 32.23sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.65 0.00 0.00 0.00 1.2443 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.65
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
pet - bron
Anima Cannon 4.0 8.00sec

Stats Details: Anima Cannon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Anima Cannon

  • id:332525
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:8.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332525
  • name:Anima Cannon
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:4.00
Vitalizing Bolt (goliath_support) 7.0 4.00sec

Stats Details: Goliath Support

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 7.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Goliath Support

  • id:332526
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:4.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite_bron
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332526
  • name:Vitalizing Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:7.00
Smash 3.0 8.17sec

Stats Details: Smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 2.1710 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Smash

  • id:341163
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:3.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:341163
  • name:Smash
  • school:physical
  • tooltip:
  • description:Attacks the ground with a heavy smash, inflicting Arcane damage to all enemies in a cone in front of the caster.

Action Priority List

    default
    [ ]:4.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.0 0.0 8.0sec 8.0sec 4.5sec 54.72% 0.00% 0.0 (0.0) 3.1

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.7s
  • trigger_min/max:1.9s / 24.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.72%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bron's Call to Action 2.0 136.1 189.5sec 2.2sec 149.5sec 99.32% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_brons_call_to_action
  • max_stacks:89
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:176.2s / 205.0s
  • trigger_min/max:0.0s / 8.1s
  • trigger_pct:100.00%
  • duration_min/max:44.7s / 201.9s

Stack Uptimes

  • brons_call_to_action_1:1.35%
  • brons_call_to_action_2:1.60%
  • brons_call_to_action_3:1.22%
  • brons_call_to_action_4:1.66%
  • brons_call_to_action_5:1.59%
  • brons_call_to_action_6:1.71%
  • brons_call_to_action_7:1.54%
  • brons_call_to_action_8:1.29%
  • brons_call_to_action_9:1.11%
  • brons_call_to_action_10:1.42%
  • brons_call_to_action_11:0.95%
  • brons_call_to_action_12:1.57%
  • brons_call_to_action_13:1.40%
  • brons_call_to_action_14:1.05%
  • brons_call_to_action_15:1.33%
  • brons_call_to_action_16:1.25%
  • brons_call_to_action_17:1.22%
  • brons_call_to_action_18:1.37%
  • brons_call_to_action_19:1.49%
  • brons_call_to_action_20:1.37%
  • brons_call_to_action_21:1.33%
  • brons_call_to_action_22:1.30%
  • brons_call_to_action_23:1.35%
  • brons_call_to_action_24:1.43%
  • brons_call_to_action_25:1.48%
  • brons_call_to_action_26:1.59%
  • brons_call_to_action_27:1.59%
  • brons_call_to_action_28:1.58%
  • brons_call_to_action_29:1.51%
  • brons_call_to_action_30:1.45%
  • brons_call_to_action_31:1.37%
  • brons_call_to_action_32:1.34%
  • brons_call_to_action_33:1.35%
  • brons_call_to_action_34:1.32%
  • brons_call_to_action_35:1.29%
  • brons_call_to_action_36:1.34%
  • brons_call_to_action_37:1.22%
  • brons_call_to_action_38:1.16%
  • brons_call_to_action_39:1.12%
  • brons_call_to_action_40:1.23%
  • brons_call_to_action_41:1.15%
  • brons_call_to_action_42:1.08%
  • brons_call_to_action_43:1.03%
  • brons_call_to_action_44:1.10%
  • brons_call_to_action_45:1.11%
  • brons_call_to_action_46:1.06%
  • brons_call_to_action_47:1.11%
  • brons_call_to_action_48:1.15%
  • brons_call_to_action_49:1.11%
  • brons_call_to_action_50:1.18%
  • brons_call_to_action_51:1.16%
  • brons_call_to_action_52:1.18%
  • brons_call_to_action_53:1.17%
  • brons_call_to_action_54:1.09%
  • brons_call_to_action_55:1.12%
  • brons_call_to_action_56:1.03%
  • brons_call_to_action_57:0.94%
  • brons_call_to_action_58:0.87%
  • brons_call_to_action_59:0.82%
  • brons_call_to_action_60:0.87%
  • brons_call_to_action_61:0.87%
  • brons_call_to_action_62:0.91%
  • brons_call_to_action_63:0.85%
  • brons_call_to_action_64:0.86%
  • brons_call_to_action_65:0.88%
  • brons_call_to_action_66:0.89%
  • brons_call_to_action_67:0.86%
  • brons_call_to_action_68:0.84%
  • brons_call_to_action_69:0.88%
  • brons_call_to_action_70:0.96%
  • brons_call_to_action_71:1.02%
  • brons_call_to_action_72:1.02%
  • brons_call_to_action_73:0.89%
  • brons_call_to_action_74:0.78%
  • brons_call_to_action_75:0.72%
  • brons_call_to_action_76:0.71%
  • brons_call_to_action_77:0.68%
  • brons_call_to_action_78:0.70%
  • brons_call_to_action_79:0.70%
  • brons_call_to_action_80:0.75%
  • brons_call_to_action_81:0.78%
  • brons_call_to_action_82:0.72%
  • brons_call_to_action_83:0.73%
  • brons_call_to_action_84:0.77%
  • brons_call_to_action_85:0.75%
  • brons_call_to_action_86:0.72%
  • brons_call_to_action_87:0.68%
  • brons_call_to_action_88:0.63%
  • brons_call_to_action_89:0.65%

Spelldata

  • id:332514
  • name:Bron's Call to Action
  • tooltip:Bron arrives in ${{$332514u=89}+1-$w1} damaging or healing spells or abilities.
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}
  • max_stacks:89
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.3s
  • trigger_min/max:180.0s / 186.3s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.3s
  • trigger_min/max:180.0s / 186.3s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.98% 8.04% 15.51% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Forgelite
soul_fire Soul Shard 6.58 6.94 7.34% 1.05 0.52 6.93%
immolate Soul Shard 347.93 33.47 35.40% 0.10 1.32 3.80%
incinerate Soul Shard 39.59 10.10 10.69% 0.26 0.03 0.32%
conflagrate Soul Shard 36.98 27.52 29.11% 0.74 0.00 0.00%
mana_regen Mana 662.91 121884.92 100.00% 183.86 28315.15 18.85%
immolate_crits Soul Shard 33.60 3.23 3.42% 0.10 0.13 3.77%
incinerate_crits Soul Shard 9.61 0.96 1.02% 0.10 0.00 0.11%
infernal Soul Shard 120.00 10.27 10.86% 0.09 1.73 14.42%
souring_tithe Soul Shard 0.99 2.04 2.16% 2.06 2.93 58.90%
pet - imp
energy_regen Energy 362.19 3571.98 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 404.95 407.88 28327.6 49116.6 47374.0 50000.0
Soul Shard 4.0 0.31 0.31 6.6 4.4 0.0 5.0
Usage Type Count Total Avg RPE APR
Kyrian_Forgelite
cataclysm Mana 9.7 4866.3 500.0 500.4 47.9
channel_demonfire Mana 12.0 9012.8 750.0 750.1 33.4
chaos_bolt Soul Shard 18.8 37.5 2.0 2.0 11949.9
conflagrate Mana 37.0 18491.4 500.0 499.8 12.9
havoc Mana 9.7 9653.2 1000.0 1000.1 0.0
immolate Mana 25.5 19122.1 750.0 750.0 25.0
incinerate Mana 39.6 39589.4 1000.0 999.9 4.2
rain_of_fire Soul Shard 18.5 55.6 3.0 3.0 5218.8
scouring_tithe Mana 13.5 13457.2 1000.0 999.8 7.4
soul_fire Mana 6.6 6577.0 1000.0 1181.6 22.0
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.6 3742.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Kyrian_Forgelite Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
Kyrian_Forgelite Damage Per Second
Count 627
Mean 9353.59
Minimum 8880.13
Maximum 10011.26
Spread ( max - min ) 1131.13
Range [ ( max - min ) / 2 * 100% ] 6.05%
Standard Deviation 210.5386
5th Percentile 9049.61
95th Percentile 9734.80
( 95th Percentile - 5th Percentile ) 685.20
Mean Distribution
Standard Deviation 8.4081
95.00% Confidence Interval ( 9337.11 - 9370.07 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1947
0.1 Scale Factor Error with Delta=300 379
0.05 Scale Factor Error with Delta=300 1514
0.01 Scale Factor Error with Delta=300 37840
Priority Target DPS
Kyrian_Forgelite Priority Target Damage Per Second
Count 627
Mean 5101.44
Minimum 4792.07
Maximum 5504.60
Spread ( max - min ) 712.52
Range [ ( max - min ) / 2 * 100% ] 6.98%
Standard Deviation 126.8947
5th Percentile 4903.06
95th Percentile 5324.88
( 95th Percentile - 5th Percentile ) 421.82
Mean Distribution
Standard Deviation 5.0677
95.00% Confidence Interval ( 5091.50 - 5111.37 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2377
0.1 Scale Factor Error with Delta=300 138
0.05 Scale Factor Error with Delta=300 550
0.01 Scale Factor Error with Delta=300 13746
DPS(e)
Kyrian_Forgelite Damage Per Second (Effective)
Count 627
Mean 9353.59
Minimum 8880.13
Maximum 10011.26
Spread ( max - min ) 1131.13
Range [ ( max - min ) / 2 * 100% ] 6.05%
Damage
Kyrian_Forgelite Damage
Count 627
Mean 2423749.39
Minimum 1942468.42
Maximum 2885036.53
Spread ( max - min ) 942568.10
Range [ ( max - min ) / 2 * 100% ] 19.44%
DTPS
Kyrian_Forgelite Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Forgelite Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Forgelite Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Forgelite Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Forgelite Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Forgelite Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_ForgeliteTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Forgelite Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.79 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.81 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.45 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.02 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.68 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.65 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 12.08 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.92 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 6.79 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 28.64 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.07 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.88 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.74 scouring_tithe
Q 7.88 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.87 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 11.15 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFLEDFFJKDLJLJADLHNRSSRQNP9EFIJLLIJAHPSNRSRQEFJFLJKILLLA9EHRNPRNQIFLJLJEILAJKLHRSNQRS9EFIFJKLAJLHNRRQNREKFFFMJDLJLA9EHPRNRNQDFLJILEKAJLLIHSNRSSQN9EFIJKAILJHSRSSNQEIFKLJLLIJALL9EHNPRNRQFNILLLE

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.934 cds M summon_infernal Fluffy_Pillow 49717.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust
0:04.942 aoe H havoc enemy2 49221.0/50000: 98% mana
4.6/5: 92% soul_shard
bloodlust
0:05.949 havoc P scouring_tithe Fluffy_Pillow 48724.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.291 havoc R chaos_bolt Fluffy_Pillow 48395.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:09.299 havoc N conflagrate Fluffy_Pillow 49399.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:10.304 havoc R chaos_bolt Fluffy_Pillow 49402.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:11.710 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:12.716 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:13.723 havoc R chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:15.129 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:16.136 aoe D rain_of_fire Fluffy_Pillow 49959.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:17.143 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
bloodlust, backdraft
0:18.148 aoe L incinerate Fluffy_Pillow 49251.5/50000: 99% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:19.086 aoe E channel_demonfire Fluffy_Pillow 48720.5/50000: 97% mana
2.7/5: 54% soul_shard
bloodlust
0:21.269 aoe D rain_of_fire Fluffy_Pillow 49062.0/50000: 98% mana
3.5/5: 70% soul_shard
bloodlust
0:22.276 aoe F immolate enemy2 49565.5/50000: 99% mana
1.0/5: 20% soul_shard
bloodlust
0:23.282 aoe F immolate Fluffy_Pillow 49252.0/50000: 99% mana
1.2/5: 24% soul_shard
bloodlust
0:24.288 aoe J conflagrate Fluffy_Pillow 49005.0/50000: 98% mana
1.7/5: 34% soul_shard
bloodlust
0:25.294 aoe K scouring_tithe Fluffy_Pillow 49008.0/50000: 98% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:26.634 aoe D rain_of_fire Fluffy_Pillow 48678.0/50000: 97% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:27.642 aoe L incinerate Fluffy_Pillow 49182.0/50000: 98% mana
0.3/5: 6% soul_shard
bloodlust, backdraft
0:28.581 aoe J conflagrate Fluffy_Pillow 48651.5/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust
0:29.587 aoe L incinerate Fluffy_Pillow 48654.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:30.527 aoe J conflagrate Fluffy_Pillow 48124.5/50000: 96% mana
2.5/5: 50% soul_shard
bloodlust
0:31.534 default A cataclysm Fluffy_Pillow 48128.0/50000: 96% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:33.076 aoe D rain_of_fire Fluffy_Pillow 48399.0/50000: 97% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:34.084 aoe L incinerate Fluffy_Pillow 48903.0/50000: 98% mana
1.4/5: 28% soul_shard
bloodlust, backdraft
0:35.025 aoe H havoc enemy2 48373.5/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust
0:36.031 havoc N conflagrate Fluffy_Pillow 47876.5/50000: 96% mana
1.9/5: 38% soul_shard
bloodlust
0:37.036 havoc R chaos_bolt Fluffy_Pillow 47879.0/50000: 96% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:38.443 havoc S incinerate Fluffy_Pillow 48582.5/50000: 97% mana
1.4/5: 28% soul_shard
bloodlust
0:39.783 havoc S incinerate Fluffy_Pillow 48252.5/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust
0:41.123 havoc R chaos_bolt Fluffy_Pillow 47922.5/50000: 96% mana
2.5/5: 50% soul_shard
0:43.733 havoc Q immolate Fluffy_Pillow 49227.5/50000: 98% mana
0.8/5: 16% soul_shard
0:45.040 havoc N conflagrate Fluffy_Pillow 49131.0/50000: 98% mana
1.2/5: 24% soul_shard
0:46.346 havoc P scouring_tithe Fluffy_Pillow 49284.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
0:48.088 default 9 soul_fire Fluffy_Pillow 49003.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
0:51.565 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
0:54.289 aoe F immolate enemy3 49614.0/50000: 99% mana
4.1/5: 82% soul_shard
backdraft
0:55.595 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
4.4/5: 88% soul_shard
0:56.901 aoe J conflagrate Fluffy_Pillow 49905.0/50000: 100% mana
1.4/5: 28% soul_shard
0:58.207 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft
0:59.428 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.6/5: 52% soul_shard
1:01.169 aoe I rain_of_fire Fluffy_Pillow 48873.5/50000: 98% mana
3.1/5: 62% soul_shard
1:02.475 aoe J conflagrate Fluffy_Pillow 49526.5/50000: 99% mana
0.1/5: 2% soul_shard
1:03.783 default A cataclysm Fluffy_Pillow 49680.5/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
1:05.523 aoe H havoc enemy2 49502.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
1:06.829 havoc P scouring_tithe Fluffy_Pillow 49155.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
1:08.568 havoc S incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
1:09.788 havoc N conflagrate Fluffy_Pillow 48611.5/50000: 97% mana
1.9/5: 38% soul_shard
1:11.095 havoc R chaos_bolt Fluffy_Pillow 48765.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
1:12.922 havoc S incinerate Fluffy_Pillow 49678.5/50000: 99% mana
1.3/5: 26% soul_shard
1:14.662 havoc R chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
1:17.272 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:18.578 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.0/5: 20% soul_shard
1:21.343 aoe F immolate enemy2 49884.5/50000: 100% mana
1.2/5: 24% soul_shard
1:22.651 aoe J conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.2/5: 24% soul_shard
1:23.958 aoe F immolate enemy3 49406.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
1:25.265 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
1:26.485 aoe J conflagrate Fluffy_Pillow 48862.5/50000: 98% mana
2.4/5: 48% soul_shard
1:27.793 aoe K scouring_tithe Fluffy_Pillow 49016.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
1:29.533 aoe I rain_of_fire Fluffy_Pillow 48886.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:30.838 aoe L incinerate Fluffy_Pillow 49539.0/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
1:32.058 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
1:33.798 aoe L incinerate Fluffy_Pillow 48872.5/50000: 98% mana
1.2/5: 24% soul_shard
1:35.538 default A cataclysm Fluffy_Pillow 48742.5/50000: 97% mana
1.8/5: 36% soul_shard
1:37.278 default 9 soul_fire Fluffy_Pillow 49112.5/50000: 98% mana
2.2/5: 44% soul_shard
1:40.754 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
3.5/5: 70% soul_shard
1:43.607 aoe H havoc enemy2 49678.0/50000: 99% mana
4.0/5: 80% soul_shard
1:44.912 havoc R chaos_bolt Fluffy_Pillow 49330.5/50000: 99% mana
4.1/5: 82% soul_shard
1:47.523 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
1:48.827 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
3.7/5: 74% soul_shard
backdraft
1:50.566 havoc R chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
1:52.393 havoc N conflagrate Fluffy_Pillow 49915.0/50000: 100% mana
2.2/5: 44% soul_shard
1:53.700 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:55.005 aoe I rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
1:56.310 aoe F immolate enemy3 49904.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:57.617 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
1:58.835 aoe J conflagrate Fluffy_Pillow 48861.5/50000: 98% mana
1.1/5: 22% soul_shard
2:00.139 aoe L incinerate Fluffy_Pillow 49013.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
2:01.356 aoe J conflagrate Fluffy_Pillow 48622.0/50000: 97% mana
2.1/5: 42% soul_shard
2:02.664 aoe E channel_demonfire Fluffy_Pillow 48776.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:05.560 aoe I rain_of_fire Fluffy_Pillow 49474.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
2:06.866 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
2:08.087 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
0.6/5: 12% soul_shard
2:09.827 aoe J conflagrate Fluffy_Pillow 49373.0/50000: 99% mana
0.7/5: 14% soul_shard
2:11.134 aoe K scouring_tithe Fluffy_Pillow 49526.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
2:12.871 aoe L incinerate Fluffy_Pillow 49000.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
2:14.089 aoe H havoc enemy2 48609.5/50000: 97% mana
2.2/5: 44% soul_shard
2:15.396 havoc R chaos_bolt Fluffy_Pillow 48263.0/50000: 97% mana
2.2/5: 44% soul_shard
2:18.007 havoc S incinerate Fluffy_Pillow 49568.5/50000: 99% mana
0.6/5: 12% soul_shard
2:19.747 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
2:21.054 havoc Q immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:22.362 havoc R chaos_bolt Fluffy_Pillow 49059.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:24.190 havoc S incinerate Fluffy_Pillow 49973.5/50000: 100% mana
1.0/5: 20% soul_shard
2:25.930 default 9 soul_fire Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
2:29.409 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
3.1/5: 62% soul_shard
2:32.232 aoe F immolate enemy3 49664.5/50000: 99% mana
3.5/5: 70% soul_shard
2:33.538 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.6/5: 72% soul_shard
2:34.844 aoe F immolate enemy2 49905.0/50000: 100% mana
0.8/5: 16% soul_shard
2:36.151 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
2:37.458 aoe K scouring_tithe Fluffy_Pillow 49406.0/50000: 99% mana
1.6/5: 32% soul_shard
backdraft
2:39.197 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
2:40.417 default A cataclysm Fluffy_Pillow 48611.5/50000: 97% mana
2.1/5: 42% soul_shard
2:42.156 aoe J conflagrate Fluffy_Pillow 48981.0/50000: 98% mana
2.3/5: 46% soul_shard
2:43.463 aoe L incinerate Fluffy_Pillow 49134.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
2:44.683 aoe H havoc enemy2 48744.5/50000: 97% mana
3.3/5: 66% soul_shard
2:45.990 havoc N conflagrate Fluffy_Pillow 48398.0/50000: 97% mana
3.4/5: 68% soul_shard
2:47.296 havoc R chaos_bolt Fluffy_Pillow 48551.0/50000: 97% mana
4.6/5: 92% soul_shard
backdraft
2:49.123 havoc R chaos_bolt Fluffy_Pillow 49464.5/50000: 99% mana
2.7/5: 54% soul_shard
2:51.733 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
2:53.039 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.3/5: 26% soul_shard
2:54.345 havoc R chaos_bolt Fluffy_Pillow 49405.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
2:56.172 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
2:59.038 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
3:00.779 aoe F immolate enemy3 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
3:02.086 aoe F immolate enemy2 48906.0/50000: 98% mana
1.3/5: 26% soul_shard
3:03.393 aoe F immolate Fluffy_Pillow 48809.5/50000: 98% mana
1.7/5: 34% soul_shard
3:04.699 cds M summon_infernal Fluffy_Pillow 48712.5/50000: 97% mana
1.7/5: 34% soul_shard
3:06.006 aoe J conflagrate Fluffy_Pillow 48366.0/50000: 97% mana
2.2/5: 44% soul_shard
3:07.312 aoe D rain_of_fire Fluffy_Pillow 48519.0/50000: 97% mana
3.0/5: 60% soul_shard
backdraft
3:08.617 aoe L incinerate Fluffy_Pillow 49171.5/50000: 98% mana
0.6/5: 12% soul_shard
backdraft
3:09.836 aoe J conflagrate Fluffy_Pillow 48781.0/50000: 98% mana
1.1/5: 22% soul_shard
3:11.372 aoe L incinerate Fluffy_Pillow 49049.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
3:12.591 default A cataclysm Fluffy_Pillow 48658.5/50000: 97% mana
2.6/5: 52% soul_shard
3:14.331 default 9 soul_fire Fluffy_Pillow 49028.5/50000: 98% mana
3.3/5: 66% soul_shard
3:17.880 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
brons_call_to_action
3:20.678 aoe H havoc enemy2 49651.0/50000: 99% mana
5.0/5: 100% soul_shard
brons_call_to_action
3:21.984 havoc P scouring_tithe Fluffy_Pillow 49304.0/50000: 99% mana
5.0/5: 100% soul_shard
brons_call_to_action(2)
3:23.725 havoc R chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
brons_call_to_action(3)
3:26.336 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
brons_call_to_action(4)
3:27.643 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft, brons_call_to_action(4)
3:29.471 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
brons_call_to_action(5)
3:30.778 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft, brons_call_to_action(5)
3:32.085 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.8/5: 96% soul_shard
backdraft, brons_call_to_action(6)
3:33.392 aoe F immolate enemy3 49906.0/50000: 100% mana
2.1/5: 42% soul_shard
backdraft, brons_call_to_action(6)
3:34.699 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, brons_call_to_action(7)
3:35.919 aoe J conflagrate Fluffy_Pillow 48862.5/50000: 98% mana
3.0/5: 60% soul_shard
brons_call_to_action(8)
3:37.321 aoe I rain_of_fire Fluffy_Pillow 49063.5/50000: 98% mana
3.8/5: 76% soul_shard
backdraft, brons_call_to_action(9)
3:38.627 aoe L incinerate Fluffy_Pillow 49716.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft, brons_call_to_action(10)
3:39.845 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
1.2/5: 24% soul_shard
brons_call_to_action(11)
3:42.664 aoe K scouring_tithe Fluffy_Pillow 49661.0/50000: 99% mana
1.6/5: 32% soul_shard
brons_call_to_action(11)
3:44.404 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
brons_call_to_action(12)
3:46.146 aoe J conflagrate Fluffy_Pillow 49373.0/50000: 99% mana
1.9/5: 38% soul_shard
brons_call_to_action(13)
3:47.451 aoe L incinerate Fluffy_Pillow 49525.5/50000: 99% mana
2.5/5: 50% soul_shard
backdraft, brons_call_to_action(13)
3:48.671 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
3.0/5: 60% soul_shard
brons_call_to_action(14)
3:50.411 aoe I rain_of_fire Fluffy_Pillow 48872.5/50000: 98% mana
3.6/5: 72% soul_shard
brons_call_to_action(15)
3:51.718 aoe H havoc enemy2 49526.0/50000: 99% mana
0.8/5: 16% soul_shard
brons_call_to_action(15)
3:53.023 havoc S incinerate Fluffy_Pillow 49178.5/50000: 98% mana
1.2/5: 24% soul_shard
brons_call_to_action(16)
3:54.763 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
brons_call_to_action(17)
3:56.069 havoc R chaos_bolt Fluffy_Pillow 49155.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, brons_call_to_action(17)
3:57.897 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
brons_call_to_action(18)
3:59.636 havoc S incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.7/5: 34% soul_shard
brons_call_to_action(19)
4:01.377 havoc Q immolate Fluffy_Pillow 48872.0/50000: 98% mana
2.4/5: 48% soul_shard
brons_call_to_action(20)
4:02.684 havoc N conflagrate Fluffy_Pillow 48775.5/50000: 98% mana
2.5/5: 50% soul_shard
brons_call_to_action(21)
4:03.991 default 9 soul_fire Fluffy_Pillow 48929.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft, brons_call_to_action(21)
4:07.469 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, brons_call_to_action(22)
4:10.231 aoe F immolate enemy3 49633.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, brons_call_to_action(22)
4:11.538 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, brons_call_to_action(23)
4:12.845 aoe J conflagrate Fluffy_Pillow 49906.0/50000: 100% mana
2.0/5: 40% soul_shard
brons_call_to_action(23)
4:14.152 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft, brons_call_to_action(24)
4:15.891 default A cataclysm Fluffy_Pillow 49001.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, brons_call_to_action(25)
4:17.880 aoe I rain_of_fire Fluffy_Pillow 49496.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft, brons_call_to_action(26)
4:19.185 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft, brons_call_to_action(26)
4:20.406 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
0.6/5: 12% soul_shard
brons_call_to_action(27)
4:21.711 aoe H havoc enemy2 49155.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft, brons_call_to_action(27)
4:23.024 havoc S incinerate Fluffy_Pillow 48812.0/50000: 98% mana
1.5/5: 30% soul_shard
backdraft, brons_call_to_action(28)
4:24.245 havoc R chaos_bolt Fluffy_Pillow 48422.5/50000: 97% mana
2.1/5: 42% soul_shard
brons_call_to_action(29)
4:26.855 havoc S incinerate Fluffy_Pillow 49727.5/50000: 99% mana
0.4/5: 8% soul_shard
brons_call_to_action(30)
4:28.595 havoc S incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
brons_call_to_action(31)
4:30.334 havoc N conflagrate Fluffy_Pillow 48871.5/50000: 98% mana
1.7/5: 34% soul_shard
brons_call_to_action(32)
4:31.639 havoc Q immolate Fluffy_Pillow 49024.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, brons_call_to_action(32)
4:32.945 aoe E channel_demonfire Fluffy_Pillow 48927.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, brons_call_to_action(33)
4:35.703 aoe I rain_of_fire Fluffy_Pillow 49556.0/50000: 99% mana
3.7/5: 74% soul_shard
backdraft, brons_call_to_action(33)
4:37.008 aoe F immolate enemy3 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, brons_call_to_action(34)
4:38.315 aoe K scouring_tithe Fluffy_Pillow 49252.5/50000: 99% mana
1.0/5: 20% soul_shard
backdraft, brons_call_to_action(35)
4:40.056 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft, brons_call_to_action(36)
4:41.275 aoe J conflagrate Fluffy_Pillow 48612.0/50000: 97% mana
1.5/5: 30% soul_shard
brons_call_to_action(37)
4:42.581 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft, brons_call_to_action(37)
4:43.800 aoe L incinerate Fluffy_Pillow 48374.5/50000: 97% mana
2.6/5: 52% soul_shard
brons_call_to_action(38)
4:45.540 aoe I rain_of_fire Fluffy_Pillow 48244.5/50000: 96% mana
3.1/5: 62% soul_shard
brons_call_to_action(39)
4:46.845 aoe J conflagrate Fluffy_Pillow 48897.0/50000: 98% mana
0.1/5: 2% soul_shard
brons_call_to_action(39)
4:48.151 default A cataclysm Fluffy_Pillow 49050.0/50000: 98% mana
0.9/5: 18% soul_shard
backdraft, brons_call_to_action(40)
4:49.891 aoe L incinerate Fluffy_Pillow 49420.0/50000: 99% mana
0.9/5: 18% soul_shard
backdraft, brons_call_to_action(41)
4:51.110 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
brons_call_to_action(42)
4:52.851 default 9 soul_fire Fluffy_Pillow 48872.5/50000: 98% mana
1.8/5: 36% soul_shard
brons_call_to_action(43)
4:56.329 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
brons_call_to_action(44)
4:59.277 aoe H havoc enemy2 49726.5/50000: 99% mana
3.5/5: 70% soul_shard
brons_call_to_action(44)
5:00.583 havoc N conflagrate Fluffy_Pillow 49379.5/50000: 99% mana
3.6/5: 72% soul_shard
brons_call_to_action(45)
5:01.890 havoc P scouring_tithe Fluffy_Pillow 49533.0/50000: 99% mana
4.9/5: 98% soul_shard
backdraft, brons_call_to_action(46)
5:03.632 havoc R chaos_bolt Fluffy_Pillow 49003.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, brons_call_to_action(47)
5:05.459 havoc N conflagrate Fluffy_Pillow 49916.5/50000: 100% mana
3.0/5: 60% soul_shard
brons_call_to_action(48)
5:06.765 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft, brons_call_to_action(48)
5:08.593 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
brons_call_to_action(49)
5:09.901 aoe F immolate enemy3 49253.0/50000: 99% mana
2.5/5: 50% soul_shard
brons_call_to_action(50)
5:11.208 havoc N conflagrate Fluffy_Pillow 49156.5/50000: 98% mana
2.6/5: 52% soul_shard
brons_call_to_action(51)
5:12.516 aoe I rain_of_fire Fluffy_Pillow 49310.5/50000: 99% mana
3.9/5: 78% soul_shard
backdraft, brons_call_to_action(51)
5:13.822 aoe L incinerate Fluffy_Pillow 49963.5/50000: 100% mana
1.0/5: 20% soul_shard
backdraft, brons_call_to_action(52)
5:15.043 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.3/5: 26% soul_shard
brons_call_to_action(53)
5:16.784 aoe L incinerate Fluffy_Pillow 48873.5/50000: 98% mana
1.9/5: 38% soul_shard
brons_call_to_action(54)
5:18.525 aoe E channel_demonfire Fluffy_Pillow 48744.0/50000: 97% mana
2.2/5: 44% soul_shard
brons_call_to_action(55)

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_Forgelite"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=333950/infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Kyrian_Kleia : 9344 dps, 5091 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9344.4 9344.4 16.0 / 0.172% 769.4 / 8.2% 19.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
407.6 404.7 Mana 0.00% 38.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Kleia 9344
Cataclysm 777 8.3% 9.7 32.38sec 24007 14127 Direct 29.2 6700 13393 8003 19.5%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.73 29.18 0.00 0.00 1.6994 0.0000 233482.82 233482.82 0.00% 14127.36 14127.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.55% 23.50 13 32 6700.11 6141 7261 6700.56 6499 6931 157459 157459 0.00%
crit 19.45% 5.68 1 12 13392.55 12283 14521 13393.65 12372 14405 76023 76023 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.81
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (997) 0.0% (10.7%) 12.0 26.10sec 25055 9240

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.97 0.00 178.88 0.00 2.7117 0.1645 0.00 0.00 0.00% 9239.98 9239.98

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.97
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 997 10.7% 0.0 0.00sec 0 0 Direct 536.6 469 939 559 19.1%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 536.63 0.00 0.00 0.0000 0.0000 299901.99 299901.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.86% 433.93 320 568 468.76 263 976 468.99 442 500 203433 203433 0.00%
crit 19.14% 102.69 60 148 939.24 525 1952 939.61 783 1096 96469 96469 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1127 (1496) 12.1% (16.0%) 18.8 15.41sec 23872 11996 Direct 37.5 (73.9) 0 9040 9040 100.0% (60.1%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.83 37.45 0.00 0.00 1.9900 0.0000 338578.29 338578.29 0.00% 11996.06 11996.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.45 26 54 9040.01 5863 12241 9039.67 8830 9230 338578 338578 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.90
  • if_expr:cast_time<havoc_remains
    Internal Combustion 369 4.0% 36.4 15.52sec 3045 0 Direct 36.4 2557 5113 3046 19.1%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.45 36.44 0.00 0.00 0.0000 0.0000 110986.02 110986.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 29.47 18 45 2556.84 1 3715 2558.32 2297 2835 75356 75356 0.00%
crit 19.13% 6.97 1 17 5112.54 5 7430 5100.02 647 6726 35630 35630 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 789 8.5% 37.0 7.95sec 6418 5136 Direct 55.0 3621 7232 4310 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.96 55.03 0.00 0.00 1.2497 0.0000 237231.67 237231.67 0.00% 5135.55 5135.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.92% 44.53 31 60 3621.13 2047 5042 3622.35 3326 3958 161279 161279 0.00%
crit 19.08% 10.50 2 22 7231.70 4094 10084 7238.82 5558 8921 75953 75953 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.88
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.07
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1591 17.1% 25.5 11.35sec 18775 14908 Direct 31.9 1517 3026 1815 19.8%
Periodic 348.1 1015 2029 1209 19.2% 95.7%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.50 31.88 348.06 348.06 1.2594 2.4837 478840.82 478840.82 0.00% 534.06 14907.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.18% 25.56 16 36 1516.66 820 2017 1517.77 1395 1656 38759 38759 0.00%
crit 19.82% 6.32 1 13 3025.54 1641 4032 3025.37 2046 3878 19128 19128 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.82% 281.30 205 351 1014.91 0 1261 1015.03 995 1041 285497 285497 0.00%
crit 19.18% 66.76 32 104 2028.70 4 2521 2028.98 1910 2129 135457 135457 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.67
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.91
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 554 5.9% 39.5 7.11sec 4225 3001 Direct 50.2 (50.2) 2780 5564 3322 19.4% (19.4%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.51 50.24 0.00 0.00 1.4077 0.0000 166910.97 166910.97 0.00% 3001.02 3001.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 40.48 25 61 2779.86 1315 3426 2782.43 2531 3003 112556 112556 0.00%
crit 19.43% 9.76 2 20 5564.05 2637 6852 5570.61 4008 6546 54355 54355 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:28.65
    havoc
    [S]:11.12
  • if_expr:cast_time<havoc_remains
Rain of Fire 967 10.3% 18.6 15.55sec 15646 12599 Periodic 440.5 553 1106 659 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.56 0.00 0.00 440.51 1.2418 0.0000 290384.37 290384.37 0.00% 12599.11 12599.11
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.75% 355.73 230 501 552.81 507 599 552.81 545 560 196651 196651 0.00%
crit 19.25% 84.78 54 125 1105.57 1013 1198 1105.64 1086 1124 93733 93733 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.49
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:12.09
Scouring Tithe 329 3.5% 13.5 22.65sec 7347 4370 Direct 18.8 1485 2963 1770 19.3%
Periodic 133.4 413 826 493 19.3% 36.3%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.48 18.81 133.37 133.37 1.6812 2.4565 99046.28 99046.28 0.00% 282.76 4370.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 15.19 7 23 1485.15 1004 1674 1485.78 1362 1674 22552 22552 0.00%
crit 19.27% 3.63 0 10 2963.11 2009 3348 2901.69 0 3348 10739 10739 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 107.58 75 148 413.15 123 419 413.14 411 416 44448 44448 0.00%
crit 19.33% 25.78 12 44 826.46 246 837 826.42 791 837 21308 21308 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:6.76
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.78
Soul Fire 479 5.1% 5.6 49.40sec 25883 7443 Direct 7.4 16235 32790 19467 19.4%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.57 7.42 0.00 0.00 3.4775 0.0000 144273.59 144273.59 0.00% 7442.92 7442.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.56% 5.97 1 9 16235.16 8600 21172 16272.22 13228 20144 96966 96966 0.00%
crit 19.44% 1.44 0 6 32790.07 17224 42339 25834.06 0 42161 47307 47307 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.77
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.90
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.9% 2.0 180.46sec 11964 10350 Direct 6.0 3348 6696 3988 19.1%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23928.22 23928.22 0.00% 10349.58 10349.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.89% 4.85 2 6 3348.13 3348 3348 3348.13 3348 3348 16249 16249 0.00%
crit 19.11% 1.15 0 4 6696.27 6696 6696 4816.62 0 6696 7679 7679 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3812 / 770
Immolation 3547 7.6% 39.0 5.49sec 5457 0 Direct 117.0 1529 3059 1820 18.9%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 212806.35 212806.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.07% 94.85 81 106 1529.13 1395 2023 1529.04 1494 1558 145026 145026 0.00%
crit 18.93% 22.15 11 36 3058.98 2790 4046 3059.80 2844 3424 67781 67781 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.6% 41.0 5.25sec 389 271 Direct 41.0 326 651 389 19.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15938.56 22766.64 29.99% 270.59 270.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 33.04 25 40 325.55 326 326 325.55 326 326 10757 15365 29.99%
crit 19.41% 7.96 1 16 651.10 651 651 651.10 651 651 5182 7402 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.5% 93.6 3.21sec 1653 1135 Direct 92.9 1395 2790 1666 19.4%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.58 92.89 0.00 0.00 1.4562 0.0000 154704.40 154704.40 0.00% 1135.24 1135.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 74.89 49 99 1395.06 1395 1395 1395.06 1395 1395 104478 104478 0.00%
crit 19.38% 18.00 5 34 2790.11 2790 2790 2790.11 2790 2790 50226 50226 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:94.02
Simple Action Stats Execute Interval
Kyrian_Kleia
Havoc 9.7 32.23sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.67 0.00 0.00 0.00 1.2444 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.67
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.0 0.0 8.0sec 8.0sec 4.5sec 54.65% 0.00% 0.0 (0.0) 3.1

Buff Details

  • buff initial source:Kyrian_Kleia
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.7s
  • trigger_min/max:1.9s / 23.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.65%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Kleia
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_Kleia_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 184.5s
  • trigger_min/max:180.0s / 184.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_Kleia_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 184.5s
  • trigger_min/max:180.0s / 184.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 11.01% 7.66% 14.54% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Kleia
soul_fire Soul Shard 6.58 6.98 7.36% 1.06 0.49 6.58%
immolate Soul Shard 348.05 33.51 35.35% 0.10 1.30 3.72%
incinerate Soul Shard 39.53 10.08 10.64% 0.26 0.03 0.33%
conflagrate Soul Shard 36.95 27.51 29.02% 0.74 0.00 0.00%
mana_regen Mana 662.58 121840.16 100.00% 183.89 28337.85 18.87%
immolate_crits Soul Shard 33.55 3.24 3.41% 0.10 0.12 3.58%
incinerate_crits Soul Shard 9.79 0.98 1.03% 0.10 0.00 0.13%
infernal Soul Shard 120.00 10.28 10.85% 0.09 1.72 14.30%
souring_tithe Soul Shard 1.05 2.22 2.34% 2.11 3.05 57.86%
pet - imp
energy_regen Energy 362.19 3571.98 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 404.75 407.62 28368.1 49135.4 47636.5 50000.0
Soul Shard 4.0 0.32 0.31 6.7 4.5 0.0 5.0
Usage Type Count Total Avg RPE APR
Kyrian_Kleia
cataclysm Mana 9.7 4866.3 500.0 500.4 48.0
channel_demonfire Mana 12.0 8977.8 750.0 750.0 33.4
chaos_bolt Soul Shard 18.8 37.6 2.0 2.0 11959.9
conflagrate Mana 37.0 18476.7 500.0 499.8 12.8
havoc Mana 9.7 9673.4 1000.0 1000.0 0.0
immolate Mana 25.5 19115.1 750.0 749.5 25.1
incinerate Mana 39.5 39530.3 1000.0 1000.5 4.2
rain_of_fire Soul Shard 18.6 55.7 3.0 3.0 5211.8
scouring_tithe Mana 13.5 13480.6 1000.0 999.9 7.3
soul_fire Mana 6.6 6583.2 1000.0 1181.0 21.9
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.6 3742.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Kyrian_Kleia Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
Kyrian_Kleia Damage Per Second
Count 627
Mean 9344.45
Minimum 8895.49
Maximum 10108.32
Spread ( max - min ) 1212.84
Range [ ( max - min ) / 2 * 100% ] 6.49%
Standard Deviation 204.9078
5th Percentile 9053.76
95th Percentile 9701.72
( 95th Percentile - 5th Percentile ) 647.96
Mean Distribution
Standard Deviation 8.1832
95.00% Confidence Interval ( 9328.41 - 9360.49 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1848
0.1 Scale Factor Error with Delta=300 359
0.05 Scale Factor Error with Delta=300 1434
0.01 Scale Factor Error with Delta=300 35843
Priority Target DPS
Kyrian_Kleia Priority Target Damage Per Second
Count 627
Mean 5091.33
Minimum 4778.01
Maximum 5508.40
Spread ( max - min ) 730.39
Range [ ( max - min ) / 2 * 100% ] 7.17%
Standard Deviation 125.4583
5th Percentile 4909.71
95th Percentile 5301.73
( 95th Percentile - 5th Percentile ) 392.02
Mean Distribution
Standard Deviation 5.0103
95.00% Confidence Interval ( 5081.51 - 5101.15 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2333
0.1 Scale Factor Error with Delta=300 135
0.05 Scale Factor Error with Delta=300 538
0.01 Scale Factor Error with Delta=300 13437
DPS(e)
Kyrian_Kleia Damage Per Second (Effective)
Count 627
Mean 9344.45
Minimum 8895.49
Maximum 10108.32
Spread ( max - min ) 1212.84
Range [ ( max - min ) / 2 * 100% ] 6.49%
Damage
Kyrian_Kleia Damage
Count 627
Mean 2423565.04
Minimum 1918768.45
Maximum 2926979.72
Spread ( max - min ) 1008211.27
Range [ ( max - min ) / 2 * 100% ] 20.80%
DTPS
Kyrian_Kleia Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Kleia Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Kleia Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Kleia Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Kleia Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Kleia Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_KleiaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Kleia Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.77 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.81 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.49 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.97 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.67 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.67 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 12.09 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.88 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 6.76 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 28.65 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.07 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.90 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.78 scouring_tithe
Q 7.91 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.90 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 11.12 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFELDFFJKLDJLJADLEHNRSRONFFIKELJILAJLHNRSPQREJFLJLIFL9AHNPRNRSQEFIJFLLJKLILAHNRSSNQS9EIFJKILJLLAHNRSRSNPFEFFMDJLLD9AHPRNRNQDEDLJFLJKFILJAHSRSNQRP9EFIJFLJLLAHNPRRNQELIJLFLLJIKL9AEHNRNRQPLJILFLEF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.993 cds M summon_infernal Fluffy_Pillow 49746.5/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:05.001 aoe H havoc enemy2 49250.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.008 havoc P scouring_tithe Fluffy_Pillow 48754.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:07.348 havoc R chaos_bolt Fluffy_Pillow 48424.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:09.359 havoc N conflagrate Fluffy_Pillow 49429.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:10.364 havoc R chaos_bolt Fluffy_Pillow 49432.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:11.770 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:12.775 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:13.783 havoc R chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, backdraft
0:15.189 havoc N conflagrate Fluffy_Pillow 49956.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:16.194 aoe D rain_of_fire Fluffy_Pillow 49958.5/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:17.200 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
bloodlust, backdraft
0:18.206 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.2/5: 44% soul_shard
bloodlust, backdraft
0:20.668 aoe L incinerate Fluffy_Pillow 49733.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:21.609 aoe D rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.4/5: 68% soul_shard
bloodlust
0:22.614 aoe F immolate enemy2 49505.5/50000: 99% mana
0.9/5: 18% soul_shard
bloodlust
0:23.620 aoe F immolate Fluffy_Pillow 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
bloodlust
0:24.627 aoe J conflagrate Fluffy_Pillow 49005.5/50000: 98% mana
1.6/5: 32% soul_shard
bloodlust
0:25.633 aoe K scouring_tithe Fluffy_Pillow 49008.5/50000: 98% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:26.974 aoe L incinerate Fluffy_Pillow 48679.0/50000: 97% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:27.915 aoe D rain_of_fire Fluffy_Pillow 48149.5/50000: 96% mana
3.6/5: 72% soul_shard
bloodlust
0:28.922 aoe J conflagrate Fluffy_Pillow 48653.0/50000: 97% mana
0.8/5: 16% soul_shard
bloodlust
0:29.927 aoe L incinerate Fluffy_Pillow 48655.5/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:30.866 aoe J conflagrate Fluffy_Pillow 48125.0/50000: 96% mana
2.3/5: 46% soul_shard
bloodlust
0:31.873 default A cataclysm Fluffy_Pillow 48128.5/50000: 96% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:33.212 aoe D rain_of_fire Fluffy_Pillow 48298.0/50000: 97% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:34.219 aoe L incinerate Fluffy_Pillow 48801.5/50000: 98% mana
1.2/5: 24% soul_shard
bloodlust, backdraft
0:35.159 aoe E channel_demonfire Fluffy_Pillow 48271.5/50000: 97% mana
1.4/5: 28% soul_shard
bloodlust
0:37.477 aoe H havoc enemy2 48680.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust
0:38.483 havoc N conflagrate Fluffy_Pillow 48183.5/50000: 96% mana
2.1/5: 42% soul_shard
bloodlust
0:39.489 havoc R chaos_bolt Fluffy_Pillow 48186.5/50000: 96% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:40.896 havoc S incinerate Fluffy_Pillow 48890.0/50000: 98% mana
1.4/5: 28% soul_shard
bloodlust
0:42.235 havoc R chaos_bolt Fluffy_Pillow 48559.5/50000: 97% mana
2.2/5: 44% soul_shard
0:44.844 havoc O soul_fire Fluffy_Pillow 49864.0/50000: 100% mana
0.6/5: 12% soul_shard
0:48.476 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
2.7/5: 54% soul_shard
0:49.782 aoe F immolate Fluffy_Pillow 49154.5/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
0:51.089 aoe F immolate enemy3 49058.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
0:52.396 aoe I rain_of_fire Fluffy_Pillow 48961.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
0:53.703 aoe K scouring_tithe Fluffy_Pillow 49615.0/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
0:55.445 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
0:58.363 aoe L incinerate Fluffy_Pillow 49712.0/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
0:59.584 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
2.1/5: 42% soul_shard
1:00.891 aoe I rain_of_fire Fluffy_Pillow 49156.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
1:02.199 aoe L incinerate Fluffy_Pillow 49810.5/50000: 100% mana
0.0/5: 0% soul_shard
backdraft
1:03.419 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
0.6/5: 12% soul_shard
1:05.162 aoe J conflagrate Fluffy_Pillow 49374.0/50000: 99% mana
0.6/5: 12% soul_shard
1:06.468 aoe L incinerate Fluffy_Pillow 49527.0/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
1:07.687 aoe H havoc enemy2 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
1:08.994 havoc N conflagrate Fluffy_Pillow 48655.5/50000: 97% mana
1.9/5: 38% soul_shard
1:10.366 havoc R chaos_bolt Fluffy_Pillow 48841.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
1:12.194 havoc S incinerate Fluffy_Pillow 49755.5/50000: 100% mana
1.2/5: 24% soul_shard
1:13.934 havoc P scouring_tithe Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
1:15.676 havoc Q immolate Fluffy_Pillow 48873.0/50000: 98% mana
2.0/5: 40% soul_shard
1:16.981 havoc R chaos_bolt Fluffy_Pillow 48775.5/50000: 98% mana
2.3/5: 46% soul_shard
1:19.590 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:22.436 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
1:23.742 aoe F immolate enemy3 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
backdraft
1:25.049 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft
1:26.268 aoe J conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
2.0/5: 40% soul_shard
1:27.664 aoe L incinerate Fluffy_Pillow 49060.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:28.886 aoe I rain_of_fire Fluffy_Pillow 48671.0/50000: 97% mana
3.0/5: 60% soul_shard
1:30.194 aoe F immolate enemy2 49325.0/50000: 99% mana
0.2/5: 4% soul_shard
1:31.499 aoe L incinerate Fluffy_Pillow 49227.5/50000: 98% mana
0.3/5: 6% soul_shard
1:33.240 default 9 soul_fire Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
1:36.951 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
1:38.693 aoe H havoc enemy2 49373.5/50000: 99% mana
2.3/5: 46% soul_shard
1:39.999 havoc N conflagrate Fluffy_Pillow 49026.5/50000: 98% mana
2.6/5: 52% soul_shard
1:41.305 havoc P scouring_tithe Fluffy_Pillow 49179.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
1:43.045 havoc R chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
1:44.872 havoc N conflagrate Fluffy_Pillow 49915.5/50000: 100% mana
2.4/5: 48% soul_shard
1:46.179 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:48.007 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
1:49.748 havoc Q immolate Fluffy_Pillow 49002.5/50000: 98% mana
2.4/5: 48% soul_shard
1:51.052 aoe E channel_demonfire Fluffy_Pillow 48904.5/50000: 98% mana
2.5/5: 50% soul_shard
1:53.791 aoe F immolate enemy2 49524.0/50000: 99% mana
2.9/5: 58% soul_shard
1:55.097 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.1/5: 62% soul_shard
1:56.403 aoe J conflagrate Fluffy_Pillow 49905.0/50000: 100% mana
0.1/5: 2% soul_shard
1:57.711 aoe F immolate enemy3 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
1:59.019 aoe L incinerate Fluffy_Pillow 49253.0/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
2:00.237 aoe L incinerate Fluffy_Pillow 48862.0/50000: 98% mana
1.4/5: 28% soul_shard
2:01.977 aoe J conflagrate Fluffy_Pillow 48732.0/50000: 97% mana
1.7/5: 34% soul_shard
2:03.283 aoe K scouring_tithe Fluffy_Pillow 48885.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:05.024 aoe L incinerate Fluffy_Pillow 48755.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:06.244 aoe I rain_of_fire Fluffy_Pillow 48365.5/50000: 97% mana
3.1/5: 62% soul_shard
2:07.553 aoe L incinerate Fluffy_Pillow 49020.0/50000: 98% mana
0.2/5: 4% soul_shard
2:09.293 default A cataclysm Fluffy_Pillow 48890.0/50000: 98% mana
0.7/5: 14% soul_shard
2:11.033 aoe H havoc enemy2 49260.0/50000: 99% mana
1.2/5: 24% soul_shard
2:12.340 havoc N conflagrate Fluffy_Pillow 48913.5/50000: 98% mana
1.2/5: 24% soul_shard
2:13.647 havoc R chaos_bolt Fluffy_Pillow 49067.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:15.476 havoc S incinerate Fluffy_Pillow 49981.5/50000: 100% mana
0.6/5: 12% soul_shard
2:17.219 havoc S incinerate Fluffy_Pillow 49003.5/50000: 98% mana
1.3/5: 26% soul_shard
2:18.960 havoc N conflagrate Fluffy_Pillow 48874.0/50000: 98% mana
2.1/5: 42% soul_shard
2:20.267 havoc Q immolate Fluffy_Pillow 49027.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
2:21.571 havoc S incinerate Fluffy_Pillow 48929.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
2:22.791 default 9 soul_fire Fluffy_Pillow 48539.5/50000: 97% mana
3.8/5: 76% soul_shard
2:26.268 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
2:29.110 aoe I rain_of_fire Fluffy_Pillow 49673.0/50000: 99% mana
5.0/5: 100% soul_shard
2:30.416 aoe F immolate enemy3 50000.0/50000: 100% mana
2.1/5: 42% soul_shard
2:31.723 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.3/5: 46% soul_shard
2:33.029 aoe K scouring_tithe Fluffy_Pillow 49405.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
2:34.769 aoe I rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
2:36.076 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
0.2/5: 4% soul_shard
backdraft
2:37.295 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.7/5: 14% soul_shard
2:38.601 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
2:39.821 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
1.7/5: 34% soul_shard
2:41.561 default A cataclysm Fluffy_Pillow 48635.0/50000: 97% mana
1.9/5: 38% soul_shard
2:43.301 aoe H havoc enemy2 49005.0/50000: 98% mana
2.2/5: 44% soul_shard
2:44.608 havoc N conflagrate Fluffy_Pillow 48658.5/50000: 97% mana
2.4/5: 48% soul_shard
2:45.915 havoc R chaos_bolt Fluffy_Pillow 48812.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
2:47.743 havoc S incinerate Fluffy_Pillow 49726.0/50000: 99% mana
1.8/5: 36% soul_shard
2:49.482 havoc R chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
2.3/5: 46% soul_shard
2:52.091 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
2:53.831 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
2:55.139 havoc P scouring_tithe Fluffy_Pillow 49156.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:56.879 aoe F immolate Fluffy_Pillow 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:58.185 aoe E channel_demonfire Fluffy_Pillow 48905.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
3:01.169 aoe F immolate enemy2 49647.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
3:02.477 aoe F immolate enemy3 49253.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
3:03.782 cds M summon_infernal Fluffy_Pillow 49155.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
3:05.300 aoe D rain_of_fire Fluffy_Pillow 48914.5/50000: 98% mana
3.7/5: 74% soul_shard
3:06.607 aoe J conflagrate Fluffy_Pillow 49568.0/50000: 99% mana
1.1/5: 22% soul_shard
3:07.914 aoe L incinerate Fluffy_Pillow 49721.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
3:09.135 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.7/5: 54% soul_shard
3:10.876 aoe D rain_of_fire Fluffy_Pillow 48873.5/50000: 98% mana
3.4/5: 68% soul_shard
3:12.181 default 9 soul_fire Fluffy_Pillow 49526.0/50000: 99% mana
0.8/5: 16% soul_shard
3:15.656 default A cataclysm Fluffy_Pillow 49001.0/50000: 98% mana
3.1/5: 62% soul_shard
3:17.396 aoe H havoc enemy2 49371.0/50000: 99% mana
3.5/5: 70% soul_shard
3:18.703 havoc P scouring_tithe Fluffy_Pillow 49024.5/50000: 98% mana
4.0/5: 80% soul_shard
3:20.442 havoc R chaos_bolt Fluffy_Pillow 48894.0/50000: 98% mana
4.5/5: 90% soul_shard
3:23.051 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:24.359 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:26.187 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:27.493 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
3:28.800 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.8/5: 96% soul_shard
backdraft
3:30.107 aoe E channel_demonfire Fluffy_Pillow 49906.0/50000: 100% mana
2.1/5: 42% soul_shard
backdraft
3:33.065 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
3:34.370 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
3:35.590 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
3:36.898 aoe F immolate enemy3 49156.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
3:38.206 aoe L incinerate Fluffy_Pillow 49060.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
3:39.425 aoe J conflagrate Fluffy_Pillow 48670.0/50000: 97% mana
2.1/5: 42% soul_shard
3:40.732 aoe K scouring_tithe Fluffy_Pillow 48823.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
3:42.473 aoe F immolate enemy2 48694.0/50000: 97% mana
3.0/5: 60% soul_shard
backdraft
3:43.779 aoe I rain_of_fire Fluffy_Pillow 48597.0/50000: 97% mana
3.1/5: 62% soul_shard
backdraft
3:45.084 aoe L incinerate Fluffy_Pillow 49249.5/50000: 98% mana
0.3/5: 6% soul_shard
backdraft
3:46.305 aoe J conflagrate Fluffy_Pillow 48860.0/50000: 98% mana
0.6/5: 12% soul_shard
3:47.613 default A cataclysm Fluffy_Pillow 49014.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
3:49.354 aoe H havoc enemy2 49384.5/50000: 99% mana
1.6/5: 32% soul_shard
backdraft
3:50.661 havoc S incinerate Fluffy_Pillow 49038.0/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
3:51.880 havoc R chaos_bolt Fluffy_Pillow 48647.5/50000: 97% mana
2.2/5: 44% soul_shard
3:54.490 havoc S incinerate Fluffy_Pillow 49952.5/50000: 100% mana
0.5/5: 10% soul_shard
3:56.230 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
3:57.537 havoc Q immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
3:58.844 havoc R chaos_bolt Fluffy_Pillow 49059.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
4:00.672 havoc P scouring_tithe Fluffy_Pillow 49973.0/50000: 100% mana
1.1/5: 22% soul_shard
4:02.413 default 9 soul_fire Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
4:05.890 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
4:08.741 aoe F immolate enemy3 49677.5/50000: 99% mana
3.0/5: 60% soul_shard
4:10.047 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.0/5: 60% soul_shard
4:11.354 aoe J conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
0.3/5: 6% soul_shard
4:12.660 aoe F immolate enemy2 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
4:13.965 aoe L incinerate Fluffy_Pillow 49251.5/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
4:15.186 aoe J conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
1.4/5: 28% soul_shard
4:16.493 aoe L incinerate Fluffy_Pillow 49015.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
4:17.713 aoe L incinerate Fluffy_Pillow 48625.5/50000: 97% mana
2.4/5: 48% soul_shard
4:19.453 default A cataclysm Fluffy_Pillow 48495.5/50000: 97% mana
2.9/5: 58% soul_shard
4:21.195 aoe H havoc enemy2 48866.5/50000: 98% mana
3.2/5: 64% soul_shard
4:22.501 havoc N conflagrate Fluffy_Pillow 48519.5/50000: 97% mana
3.2/5: 64% soul_shard
4:23.808 havoc P scouring_tithe Fluffy_Pillow 48673.0/50000: 97% mana
4.5/5: 90% soul_shard
backdraft
4:25.548 havoc R chaos_bolt Fluffy_Pillow 48543.0/50000: 97% mana
4.5/5: 90% soul_shard
backdraft
4:27.377 havoc R chaos_bolt Fluffy_Pillow 49457.5/50000: 99% mana
2.8/5: 56% soul_shard
4:29.987 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
4:31.295 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
4:32.601 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.4/5: 48% soul_shard
backdraft
4:35.428 aoe L incinerate Fluffy_Pillow 49915.5/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
4:36.648 aoe I rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.5/5: 70% soul_shard
4:37.953 aoe J conflagrate Fluffy_Pillow 49655.0/50000: 99% mana
0.5/5: 10% soul_shard
4:39.260 aoe L incinerate Fluffy_Pillow 49808.5/50000: 100% mana
1.3/5: 26% soul_shard
backdraft
4:40.480 aoe F immolate enemy3 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
4:41.787 aoe L incinerate Fluffy_Pillow 48906.0/50000: 98% mana
1.9/5: 38% soul_shard
4:43.529 aoe L incinerate Fluffy_Pillow 48777.0/50000: 98% mana
2.1/5: 42% soul_shard
4:45.269 aoe J conflagrate Fluffy_Pillow 48647.0/50000: 97% mana
2.6/5: 52% soul_shard
4:46.589 aoe I rain_of_fire Fluffy_Pillow 48807.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
4:47.896 aoe K scouring_tithe Fluffy_Pillow 49460.5/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
4:49.636 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
backdraft
4:50.856 default 9 soul_fire Fluffy_Pillow 48612.0/50000: 97% mana
1.0/5: 20% soul_shard
4:54.365 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
2.7/5: 54% soul_shard
4:56.105 aoe E channel_demonfire Fluffy_Pillow 49373.0/50000: 99% mana
2.8/5: 56% soul_shard
4:58.849 aoe H havoc enemy2 49995.0/50000: 100% mana
3.1/5: 62% soul_shard
5:00.155 havoc N conflagrate Fluffy_Pillow 49648.0/50000: 99% mana
3.2/5: 64% soul_shard
5:01.463 havoc R chaos_bolt Fluffy_Pillow 49802.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
5:03.291 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
5:04.598 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.7/5: 74% soul_shard
backdraft
5:06.425 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
5:07.732 havoc P scouring_tithe Fluffy_Pillow 49252.5/50000: 99% mana
2.1/5: 42% soul_shard
5:09.474 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.3/5: 46% soul_shard
5:11.216 aoe J conflagrate Fluffy_Pillow 48874.0/50000: 98% mana
2.6/5: 52% soul_shard
5:12.535 aoe I rain_of_fire Fluffy_Pillow 49033.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
5:13.842 aoe L incinerate Fluffy_Pillow 49687.0/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
5:15.062 aoe F immolate enemy3 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
5:16.368 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
1.0/5: 20% soul_shard
5:18.108 aoe E channel_demonfire Fluffy_Pillow 48775.5/50000: 98% mana
1.5/5: 30% soul_shard
5:20.989 aoe F immolate enemy2 49466.0/50000: 99% mana
1.9/5: 38% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_Kleia"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Kyrian_Kleia_Courage : 9688 dps, 5244 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9687.6 9687.6 17.0 / 0.175% 845.7 / 8.7% 20.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
406.4 403.5 Mana 0.00% 38.3 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Kleia_Courage 9688
Cataclysm 808 8.3% 9.7 32.34sec 24972 14695 Direct 29.2 6698 13404 8326 24.2%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.73 29.18 0.00 0.00 1.6994 0.0000 242908.50 242908.50 0.00% 14695.01 14695.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.77% 22.11 13 32 6698.12 6142 7261 6697.75 6432 6910 148101 148101 0.00%
crit 24.23% 7.07 1 15 13403.90 12284 14521 13405.49 12443 14393 94807 94807 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.81
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1056) 0.0% (10.9%) 12.2 25.39sec 26057 9613

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.19 0.00 182.19 0.00 2.7107 0.1645 0.00 0.00 0.00% 9612.84 9612.84

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.18
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1056 10.9% 0.0 0.00sec 0 0 Direct 546.6 467 935 581 24.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 546.56 0.00 0.00 0.0000 0.0000 317588.88 317588.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.69% 413.71 298 546 467.27 263 976 467.32 432 503 193309 193309 0.00%
crit 24.31% 132.85 77 178 935.20 525 1952 935.97 826 1054 124280 124280 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1177 (1563) 12.2% (16.1%) 18.9 15.48sec 24872 12518 Direct 37.6 (74.0) 0 9415 9415 100.0% (62.7%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.89 37.58 0.00 0.00 1.9870 0.0000 353779.18 353779.18 0.00% 12518.00 12518.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.58 28 52 9415.30 6109 12754 9415.00 9154 9630 353779 353779 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.96
  • if_expr:cast_time<havoc_remains
    Internal Combustion 386 4.0% 36.4 15.50sec 3185 0 Direct 36.4 2566 5125 3184 24.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.40 36.40 0.00 0.00 0.0000 0.0000 115933.86 115933.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.77% 27.58 16 42 2565.69 1 3715 2567.53 2287 2837 70718 70718 0.00%
crit 24.23% 8.82 2 18 5124.93 2 7430 5133.00 3245 6385 45216 45216 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 824 8.5% 37.0 7.96sec 6698 5360 Direct 55.1 3618 7275 4497 24.0%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.98 55.08 0.00 0.00 1.2497 0.0000 247670.81 247670.81 0.00% 5359.91 5359.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.98% 41.85 27 57 3618.48 2047 5042 3619.51 3374 3881 151455 151455 0.00%
crit 24.02% 13.23 4 25 7275.06 4094 10084 7273.63 6014 8756 96215 96215 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.87
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.10
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1658 17.1% 25.6 11.19sec 19482 15466 Direct 31.9 1517 3030 1885 24.3%
Periodic 347.9 1015 2031 1261 24.2% 95.7%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.60 31.92 347.91 347.91 1.2596 2.4828 498794.56 498794.56 0.00% 556.66 15466.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.73% 24.17 12 35 1517.46 819 2017 1518.33 1397 1662 36681 36681 0.00%
crit 24.27% 7.75 1 17 3030.49 1638 4033 3028.31 2185 3580 23475 23475 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 75.78% 263.64 190 341 1014.56 0 1261 1014.64 992 1042 267473 267473 0.00%
crit 24.22% 84.27 52 121 2030.98 1 2521 2031.58 1949 2121 171165 171165 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.71
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.98
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 573 5.9% 39.0 7.30sec 4421 3140 Direct 50.0 (50.0) 2773 5562 3450 24.2% (24.2%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.01 50.01 0.00 0.00 1.4081 0.0000 172463.78 172463.78 0.00% 3139.64 3139.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.79% 37.90 23 53 2773.13 1315 3426 2774.32 2554 2994 105137 105137 0.00%
crit 24.21% 12.11 3 24 5561.95 2690 6852 5563.07 4418 6356 67327 67327 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:27.83
    havoc
    [S]:11.35
  • if_expr:cast_time<havoc_remains
Rain of Fire 1014 10.5% 18.7 15.36sec 16305 13125 Periodic 443.6 553 1106 687 24.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.69 0.00 0.00 443.56 1.2423 0.0000 304794.91 304794.91 0.00% 13124.70 13124.70
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 75.72% 335.87 213 440 552.95 507 599 552.97 546 559 185721 185721 0.00%
crit 24.28% 107.68 68 156 1105.78 1013 1198 1105.80 1088 1126 119074 119074 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.42
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:12.28
Scouring Tithe 341 3.5% 13.4 22.74sec 7676 4567 Direct 18.6 1484 2976 1858 25.0%
Periodic 132.3 413 827 514 24.4% 36.0%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.37 18.62 132.34 132.34 1.6806 2.4556 102597.72 102597.72 0.00% 295.29 4567.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.96% 13.96 7 23 1484.43 1004 1674 1485.42 1339 1674 20711 20711 0.00%
crit 25.04% 4.66 0 11 2976.39 2009 3348 2965.97 0 3348 13878 13878 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 75.62% 100.08 69 146 413.09 123 419 413.07 409 416 41343 41343 0.00%
crit 24.38% 32.26 15 55 826.58 246 837 826.54 801 837 26665 26665 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:7.06
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.40
Soul Fire 491 5.1% 5.6 49.47sec 26559 7638 Direct 7.4 16402 33018 20095 22.2%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.57 7.36 0.00 0.00 3.4775 0.0000 147834.91 147834.91 0.00% 7637.68 7637.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.76% 5.72 1 10 16401.78 8599 21165 16446.75 12638 19888 93773 93773 0.00%
crit 22.24% 1.64 0 5 33018.01 17203 42325 27829.17 0 42292 54062 54062 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.79
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.86
  • if_expr:cast_time<havoc_remains
Summon Infernal 85 0.9% 2.0 180.70sec 12589 10885 Direct 6.0 3348 6696 4193 25.3%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 25177.76 25177.76 0.00% 10885.33 10885.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.67% 4.48 1 6 3348.13 3348 3348 3348.13 3348 3348 15000 15000 0.00%
crit 25.33% 1.52 0 5 6696.27 6696 6696 5564.21 0 6696 10178 10178 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3655 / 739
Immolation 3379 7.0% 39.0 5.50sec 5199 0 Direct 117.0 1395 2790 1733 24.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 202741.50 202741.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.79% 88.67 75 102 1395.06 1395 1395 1395.06 1395 1395 123702 123702 0.00%
crit 24.21% 28.33 15 42 2790.11 2790 2790 2790.11 2790 2790 79040 79040 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 276 0.6% 41.0 5.26sec 404 281 Direct 41.0 326 651 404 24.2%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16580.84 23684.07 29.99% 281.49 281.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.78% 31.07 23 39 325.55 326 326 325.55 326 326 10114 14447 29.99%
crit 24.22% 9.93 2 18 651.10 651 651 651.10 651 651 6466 9237 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 537 / 537
Firebolt 537 5.5% 93.6 3.21sec 1725 1184 Direct 92.9 1395 2790 1737 24.5%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.58 92.89 0.00 0.00 1.4562 0.0000 161394.88 161394.88 0.00% 1184.33 1184.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.46% 70.10 50 93 1395.06 1395 1395 1395.06 1395 1395 97787 97787 0.00%
crit 24.54% 22.80 13 37 2790.11 2790 2790 2790.11 2790 2790 63607 63607 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:94.02
Simple Action Stats Execute Interval
Kyrian_Kleia_Courage
Havoc 9.7 32.18sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.67 0.00 0.00 0.00 1.2445 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.68
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.0 0.0 8.0sec 8.0sec 4.5sec 55.10% 0.00% 0.0 (0.0) 3.1

Buff Details

  • buff initial source:Kyrian_Kleia_Courage
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.7s
  • trigger_min/max:1.9s / 24.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:55.10%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Kleia_Courage
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_Kleia_Courage_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 183.7s
  • trigger_min/max:180.0s / 183.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_Kleia_Courage_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 183.7s
  • trigger_min/max:180.0s / 183.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Pointed Courage

Buff Details

  • buff initial source:Kyrian_Kleia_Courage
  • cooldown name:buff_pointed_courage
  • max_stacks:8
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:330511
  • name:Pointed Courage
  • tooltip:Chance to critical strike increased by $w%.
  • description:{$@spelldesc329778=Chance to critical strike is increased by {$330511s1=1}% for every nearby enemy or ally, up to {$330511u=8}%.}
  • max_stacks:8
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.95% 8.23% 14.56% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Kleia_Courage
soul_fire Soul Shard 6.57 6.87 7.22% 1.05 0.54 7.34%
immolate Soul Shard 347.93 33.35 35.02% 0.10 1.44 4.15%
incinerate Soul Shard 39.01 10.05 10.55% 0.26 0.02 0.21%
conflagrate Soul Shard 36.97 27.53 28.92% 0.74 0.00 0.00%
mana_regen Mana 666.49 121438.51 100.00% 182.20 28745.42 19.14%
immolate_crits Soul Shard 42.04 4.03 4.23% 0.10 0.17 4.11%
incinerate_crits Soul Shard 12.15 1.21 1.27% 0.10 0.00 0.15%
infernal Soul Shard 120.00 10.13 10.64% 0.08 1.87 15.60%
souring_tithe Soul Shard 1.00 2.04 2.14% 2.05 2.94 59.03%
pet - imp
energy_regen Energy 362.19 3571.98 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 403.46 406.37 28769.9 49122.6 47478.5 50000.0
Soul Shard 4.0 0.32 0.31 7.0 4.4 0.0 5.0
Usage Type Count Total Avg RPE APR
Kyrian_Kleia_Courage
cataclysm Mana 9.7 4867.0 500.0 500.3 49.9
channel_demonfire Mana 12.2 9135.3 750.0 749.5 34.8
chaos_bolt Soul Shard 18.9 37.7 2.0 2.0 12455.7
conflagrate Mana 37.0 18485.2 500.0 499.9 13.4
havoc Mana 9.7 9679.6 1000.0 1000.7 0.0
immolate Mana 25.6 19196.7 750.0 749.8 26.0
incinerate Mana 39.0 39014.0 1000.0 1000.1 4.4
rain_of_fire Soul Shard 18.7 56.1 3.0 3.0 5433.1
scouring_tithe Mana 13.4 13370.1 1000.0 1000.2 7.7
soul_fire Mana 6.6 6572.3 1000.0 1180.8 22.5
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.6
pet - imp
firebolt Energy 93.6 3742.8 40.0 40.0 43.1

Statistics & Data Analysis

Fight Length
Kyrian_Kleia_Courage Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
Kyrian_Kleia_Courage Damage Per Second
Count 627
Mean 9687.58
Minimum 9150.23
Maximum 10422.58
Spread ( max - min ) 1272.35
Range [ ( max - min ) / 2 * 100% ] 6.57%
Standard Deviation 216.8977
5th Percentile 9355.92
95th Percentile 10072.73
( 95th Percentile - 5th Percentile ) 716.81
Mean Distribution
Standard Deviation 8.6621
95.00% Confidence Interval ( 9670.60 - 9704.55 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1926
0.1 Scale Factor Error with Delta=300 402
0.05 Scale Factor Error with Delta=300 1607
0.01 Scale Factor Error with Delta=300 40161
Priority Target DPS
Kyrian_Kleia_Courage Priority Target Damage Per Second
Count 627
Mean 5244.04
Minimum 4884.87
Maximum 5666.63
Spread ( max - min ) 781.77
Range [ ( max - min ) / 2 * 100% ] 7.45%
Standard Deviation 131.8610
5th Percentile 5047.58
95th Percentile 5483.49
( 95th Percentile - 5th Percentile ) 435.92
Mean Distribution
Standard Deviation 5.2660
95.00% Confidence Interval ( 5233.72 - 5254.36 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2429
0.1 Scale Factor Error with Delta=300 149
0.05 Scale Factor Error with Delta=300 594
0.01 Scale Factor Error with Delta=300 14843
DPS(e)
Kyrian_Kleia_Courage Damage Per Second (Effective)
Count 627
Mean 9687.58
Minimum 9150.23
Maximum 10422.58
Spread ( max - min ) 1272.35
Range [ ( max - min ) / 2 * 100% ] 6.57%
Damage
Kyrian_Kleia_Courage Damage
Count 627
Mean 2529544.88
Minimum 2003424.28
Maximum 3027310.99
Spread ( max - min ) 1023886.71
Range [ ( max - min ) / 2 * 100% ] 20.24%
DTPS
Kyrian_Kleia_Courage Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Kleia_Courage Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Kleia_Courage Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Kleia_Courage Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Kleia_Courage Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Kleia_Courage Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_Kleia_CourageTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Kleia_Courage Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.79 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.81 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.42 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.18 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.71 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.68 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 12.28 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.87 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 7.06 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 27.83 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.10 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.86 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.40 scouring_tithe
Q 7.98 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.96 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 11.35 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFEDLFFJKDLJLJADLEHNRSRNPS9FFEFIJLAJIHPSNRSSNEFFFILJKILLA9EHNRNPRNQIFLLJELLAIJKHSRNRQS9EFIFJKLAJLHNRRQSNEIKFMLJFFDLAJ9EHPRNRNQDFLJILEKAJLLLHNRRQNRP9EFFJIALJLHPRNRQSEFJLILJKLLAIHONRNREKFFFJILLJ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.073 cds M summon_infernal Fluffy_Pillow 49786.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.080 aoe H havoc enemy2 49290.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.087 havoc P scouring_tithe Fluffy_Pillow 48793.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:07.427 havoc R chaos_bolt Fluffy_Pillow 48463.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:09.436 havoc N conflagrate Fluffy_Pillow 49468.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:10.444 havoc R chaos_bolt Fluffy_Pillow 49472.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:11.849 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:12.857 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:13.864 havoc R chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.7/5: 94% soul_shard
bloodlust, backdraft
0:15.271 havoc N conflagrate Fluffy_Pillow 49956.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:16.277 aoe D rain_of_fire Fluffy_Pillow 49959.0/50000: 100% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:17.286 aoe F immolate enemy3 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:18.293 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:20.720 aoe D rain_of_fire Fluffy_Pillow 49716.0/50000: 99% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:21.727 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
bloodlust, backdraft
0:22.666 aoe F immolate enemy2 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
bloodlust
0:23.672 aoe F immolate Fluffy_Pillow 48755.0/50000: 98% mana
1.3/5: 26% soul_shard
bloodlust
0:24.679 aoe J conflagrate Fluffy_Pillow 48508.5/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust
0:25.688 aoe K scouring_tithe Fluffy_Pillow 48513.0/50000: 97% mana
2.7/5: 54% soul_shard
bloodlust, backdraft
0:27.027 aoe D rain_of_fire Fluffy_Pillow 48182.5/50000: 96% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:28.034 aoe L incinerate Fluffy_Pillow 48686.0/50000: 97% mana
0.8/5: 16% soul_shard
bloodlust, backdraft
0:28.975 aoe J conflagrate Fluffy_Pillow 48156.5/50000: 96% mana
1.2/5: 24% soul_shard
bloodlust
0:29.980 aoe L incinerate Fluffy_Pillow 48159.0/50000: 96% mana
2.2/5: 44% soul_shard
bloodlust, backdraft
0:30.921 aoe J conflagrate Fluffy_Pillow 47629.5/50000: 95% mana
2.7/5: 54% soul_shard
bloodlust
0:31.928 default A cataclysm Fluffy_Pillow 47633.0/50000: 95% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:33.267 aoe D rain_of_fire Fluffy_Pillow 47802.5/50000: 96% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:34.274 aoe L incinerate Fluffy_Pillow 48306.0/50000: 97% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:35.213 aoe E channel_demonfire Fluffy_Pillow 47775.5/50000: 96% mana
1.7/5: 34% soul_shard
bloodlust
0:37.485 aoe H havoc enemy2 48161.5/50000: 96% mana
2.3/5: 46% soul_shard
bloodlust
0:38.492 havoc N conflagrate Fluffy_Pillow 47665.0/50000: 95% mana
2.6/5: 52% soul_shard
bloodlust
0:39.497 havoc R chaos_bolt Fluffy_Pillow 47667.5/50000: 95% mana
3.6/5: 72% soul_shard
bloodlust, backdraft
0:40.902 havoc S incinerate Fluffy_Pillow 48370.0/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust
0:42.242 havoc R chaos_bolt Fluffy_Pillow 48040.0/50000: 96% mana
2.8/5: 56% soul_shard
0:44.851 havoc N conflagrate Fluffy_Pillow 49344.5/50000: 99% mana
1.1/5: 22% soul_shard
0:46.158 havoc P scouring_tithe Fluffy_Pillow 49498.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
0:47.899 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
0:49.119 default 9 soul_fire Fluffy_Pillow 48612.5/50000: 97% mana
2.7/5: 54% soul_shard
0:52.597 aoe F immolate Fluffy_Pillow 49002.5/50000: 98% mana
3.9/5: 78% soul_shard
0:53.904 aoe F immolate enemy2 48906.0/50000: 98% mana
3.9/5: 78% soul_shard
0:55.209 aoe E channel_demonfire Fluffy_Pillow 48808.5/50000: 98% mana
4.0/5: 80% soul_shard
0:58.142 aoe F immolate enemy3 49525.0/50000: 99% mana
4.3/5: 86% soul_shard
0:59.448 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
4.4/5: 88% soul_shard
1:00.754 aoe J conflagrate Fluffy_Pillow 49905.0/50000: 100% mana
1.6/5: 32% soul_shard
1:02.060 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft
1:03.281 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
2.7/5: 54% soul_shard
1:05.021 aoe J conflagrate Fluffy_Pillow 49373.0/50000: 99% mana
3.0/5: 60% soul_shard
1:06.327 aoe I rain_of_fire Fluffy_Pillow 49526.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
1:07.633 aoe H havoc enemy2 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
1:08.939 havoc P scouring_tithe Fluffy_Pillow 49653.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
1:10.680 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
1:11.899 havoc N conflagrate Fluffy_Pillow 48612.0/50000: 97% mana
1.7/5: 34% soul_shard
1:13.204 havoc R chaos_bolt Fluffy_Pillow 48764.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
1:15.032 havoc S incinerate Fluffy_Pillow 49678.5/50000: 99% mana
1.3/5: 26% soul_shard
1:16.772 havoc S incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
1:18.512 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.5/5: 50% soul_shard
1:19.820 aoe E channel_demonfire Fluffy_Pillow 49026.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
1:22.643 aoe F immolate Fluffy_Pillow 49687.5/50000: 99% mana
4.3/5: 86% soul_shard
backdraft
1:23.950 aoe F immolate enemy3 49252.5/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
1:25.255 aoe F immolate enemy2 49155.0/50000: 98% mana
4.7/5: 94% soul_shard
backdraft
1:26.560 aoe I rain_of_fire Fluffy_Pillow 49057.5/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
1:27.865 aoe L incinerate Fluffy_Pillow 49710.0/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
1:29.084 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
1:30.392 aoe K scouring_tithe Fluffy_Pillow 49156.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
1:32.133 aoe I rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:33.440 aoe L incinerate Fluffy_Pillow 49656.0/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
1:34.659 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
1:36.397 default A cataclysm Fluffy_Pillow 48871.0/50000: 98% mana
1.1/5: 22% soul_shard
1:38.139 default 9 soul_fire Fluffy_Pillow 49242.0/50000: 98% mana
1.3/5: 26% soul_shard
1:41.616 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
1:44.403 aoe H havoc enemy2 49645.5/50000: 99% mana
3.1/5: 62% soul_shard
1:45.710 havoc N conflagrate Fluffy_Pillow 49299.0/50000: 99% mana
3.3/5: 66% soul_shard
1:47.017 havoc R chaos_bolt Fluffy_Pillow 49452.5/50000: 99% mana
4.4/5: 88% soul_shard
backdraft
1:48.844 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
1:50.150 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
backdraft
1:51.890 havoc R chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
1:53.718 havoc N conflagrate Fluffy_Pillow 49916.0/50000: 100% mana
2.2/5: 44% soul_shard
1:55.025 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft
1:56.332 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
1:57.638 aoe F immolate enemy3 49905.5/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:58.944 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
2:00.162 aoe L incinerate Fluffy_Pillow 48861.0/50000: 98% mana
1.1/5: 22% soul_shard
2:01.903 aoe J conflagrate Fluffy_Pillow 48731.5/50000: 97% mana
1.5/5: 30% soul_shard
2:03.210 aoe E channel_demonfire Fluffy_Pillow 48885.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
2:06.157 aoe L incinerate Fluffy_Pillow 49608.5/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
2:07.377 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
3.0/5: 60% soul_shard
2:09.117 default A cataclysm Fluffy_Pillow 48872.5/50000: 98% mana
3.4/5: 68% soul_shard
2:10.858 aoe I rain_of_fire Fluffy_Pillow 49243.0/50000: 98% mana
3.8/5: 76% soul_shard
2:12.166 aoe J conflagrate Fluffy_Pillow 49897.0/50000: 100% mana
0.9/5: 18% soul_shard
2:13.474 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
backdraft
2:15.215 aoe H havoc enemy2 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
2:16.521 havoc S incinerate Fluffy_Pillow 48655.5/50000: 97% mana
1.9/5: 38% soul_shard
backdraft
2:17.742 havoc R chaos_bolt Fluffy_Pillow 48266.0/50000: 97% mana
2.5/5: 50% soul_shard
2:20.350 havoc N conflagrate Fluffy_Pillow 49570.0/50000: 99% mana
1.0/5: 20% soul_shard
2:21.656 havoc R chaos_bolt Fluffy_Pillow 49723.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
2:23.484 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
2:24.792 havoc S incinerate Fluffy_Pillow 49253.0/50000: 99% mana
0.4/5: 8% soul_shard
2:26.532 default 9 soul_fire Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:30.090 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.5/5: 50% soul_shard
2:32.933 aoe F immolate enemy3 49674.0/50000: 99% mana
2.9/5: 58% soul_shard
2:34.240 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.0/5: 60% soul_shard
2:35.549 aoe F immolate enemy2 49907.0/50000: 100% mana
0.3/5: 6% soul_shard
2:36.856 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
0.4/5: 8% soul_shard
2:38.163 aoe K scouring_tithe Fluffy_Pillow 49406.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
2:39.903 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
2:41.121 default A cataclysm Fluffy_Pillow 48611.0/50000: 97% mana
1.8/5: 36% soul_shard
2:42.861 aoe J conflagrate Fluffy_Pillow 48981.0/50000: 98% mana
1.9/5: 38% soul_shard
2:44.168 aoe L incinerate Fluffy_Pillow 49134.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:45.388 aoe H havoc enemy2 48744.5/50000: 97% mana
2.9/5: 58% soul_shard
2:46.695 havoc N conflagrate Fluffy_Pillow 48398.0/50000: 97% mana
3.1/5: 62% soul_shard
2:48.002 havoc R chaos_bolt Fluffy_Pillow 48551.5/50000: 97% mana
4.2/5: 84% soul_shard
backdraft
2:49.829 havoc R chaos_bolt Fluffy_Pillow 49465.0/50000: 99% mana
2.4/5: 48% soul_shard
2:52.439 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
2:53.746 havoc S incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
2:55.486 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
2:56.793 aoe E channel_demonfire Fluffy_Pillow 49155.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:59.532 aoe I rain_of_fire Fluffy_Pillow 49775.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
3:00.839 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
0.1/5: 2% soul_shard
backdraft
3:02.579 aoe F immolate enemy3 49002.0/50000: 98% mana
0.3/5: 6% soul_shard
backdraft
3:03.885 cds M summon_infernal Fluffy_Pillow 48905.0/50000: 98% mana
0.4/5: 8% soul_shard
backdraft
3:05.379 aoe L incinerate Fluffy_Pillow 48652.0/50000: 97% mana
0.8/5: 16% soul_shard
backdraft
3:06.597 aoe J conflagrate Fluffy_Pillow 48261.0/50000: 97% mana
1.4/5: 28% soul_shard
3:07.905 aoe F immolate enemy2 48415.0/50000: 97% mana
2.5/5: 50% soul_shard
backdraft
3:09.211 aoe F immolate Fluffy_Pillow 48318.0/50000: 97% mana
2.9/5: 58% soul_shard
backdraft
3:10.518 aoe D rain_of_fire Fluffy_Pillow 48221.5/50000: 96% mana
3.3/5: 66% soul_shard
backdraft
3:11.824 aoe L incinerate Fluffy_Pillow 48874.5/50000: 98% mana
0.7/5: 14% soul_shard
backdraft
3:13.042 default A cataclysm Fluffy_Pillow 48483.5/50000: 97% mana
1.3/5: 26% soul_shard
3:14.782 aoe J conflagrate Fluffy_Pillow 48853.5/50000: 98% mana
1.9/5: 38% soul_shard
3:16.089 default 9 soul_fire Fluffy_Pillow 49007.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
3:19.568 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
3:22.365 aoe H havoc enemy2 49651.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
3:23.671 havoc P scouring_tithe Fluffy_Pillow 49304.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
3:25.410 havoc R chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
3:28.022 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:29.327 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:31.154 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:32.460 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
3:33.767 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.8/5: 96% soul_shard
backdraft
3:35.074 aoe F immolate enemy3 49906.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft
3:36.379 aoe L incinerate Fluffy_Pillow 49251.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
3:37.598 aoe J conflagrate Fluffy_Pillow 48861.0/50000: 98% mana
2.5/5: 50% soul_shard
3:38.903 aoe I rain_of_fire Fluffy_Pillow 49013.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
3:40.211 aoe L incinerate Fluffy_Pillow 49667.5/50000: 99% mana
0.3/5: 6% soul_shard
backdraft
3:41.428 aoe E channel_demonfire Fluffy_Pillow 49001.0/50000: 98% mana
0.6/5: 12% soul_shard
3:44.246 aoe K scouring_tithe Fluffy_Pillow 49660.0/50000: 99% mana
1.0/5: 20% soul_shard
3:45.987 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
3:47.728 aoe J conflagrate Fluffy_Pillow 49373.0/50000: 99% mana
1.5/5: 30% soul_shard
3:49.035 aoe L incinerate Fluffy_Pillow 49526.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
3:50.254 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
3:51.994 aoe L incinerate Fluffy_Pillow 48872.0/50000: 98% mana
2.8/5: 56% soul_shard
3:53.734 aoe H havoc enemy2 48742.0/50000: 97% mana
3.4/5: 68% soul_shard
3:55.041 havoc N conflagrate Fluffy_Pillow 48395.5/50000: 97% mana
3.7/5: 74% soul_shard
3:56.347 havoc R chaos_bolt Fluffy_Pillow 48548.5/50000: 97% mana
4.7/5: 94% soul_shard
backdraft
3:58.173 havoc R chaos_bolt Fluffy_Pillow 49461.5/50000: 99% mana
3.0/5: 60% soul_shard
4:00.781 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
4:02.088 havoc N conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.4/5: 28% soul_shard
4:03.447 havoc R chaos_bolt Fluffy_Pillow 49432.0/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
4:05.274 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
4:07.016 default 9 soul_fire Fluffy_Pillow 49003.0/50000: 98% mana
1.0/5: 20% soul_shard
4:10.491 aoe E channel_demonfire Fluffy_Pillow 49001.0/50000: 98% mana
2.4/5: 48% soul_shard
4:13.357 aoe F immolate enemy3 49684.0/50000: 99% mana
2.8/5: 56% soul_shard
4:14.665 aoe F immolate enemy2 49253.0/50000: 99% mana
2.8/5: 56% soul_shard
4:15.970 aoe J conflagrate Fluffy_Pillow 49155.5/50000: 98% mana
2.9/5: 58% soul_shard
4:17.277 aoe I rain_of_fire Fluffy_Pillow 49309.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
4:18.582 default A cataclysm Fluffy_Pillow 49961.5/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
4:20.323 aoe L incinerate Fluffy_Pillow 49502.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
4:21.543 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
4:22.848 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
4:24.067 aoe H havoc enemy2 48764.5/50000: 98% mana
2.5/5: 50% soul_shard
4:25.374 havoc P scouring_tithe Fluffy_Pillow 48418.0/50000: 97% mana
2.6/5: 52% soul_shard
4:27.112 havoc R chaos_bolt Fluffy_Pillow 48287.0/50000: 97% mana
2.8/5: 56% soul_shard
4:29.722 havoc N conflagrate Fluffy_Pillow 49592.0/50000: 99% mana
1.1/5: 22% soul_shard
4:31.029 havoc R chaos_bolt Fluffy_Pillow 49745.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
4:32.856 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
4:34.163 havoc S incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
4:35.904 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
4:38.757 aoe F immolate enemy3 49679.0/50000: 99% mana
1.8/5: 36% soul_shard
4:40.063 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.2/5: 44% soul_shard
4:41.369 aoe L incinerate Fluffy_Pillow 49405.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
4:42.589 aoe I rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.3/5: 66% soul_shard
4:43.895 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
0.4/5: 8% soul_shard
4:45.636 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
4:46.940 aoe K scouring_tithe Fluffy_Pillow 49154.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
4:48.680 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
4:49.897 aoe L incinerate Fluffy_Pillow 48610.5/50000: 97% mana
2.4/5: 48% soul_shard
4:51.636 default A cataclysm Fluffy_Pillow 48480.0/50000: 97% mana
2.7/5: 54% soul_shard
4:53.377 aoe I rain_of_fire Fluffy_Pillow 48850.5/50000: 98% mana
3.0/5: 60% soul_shard
4:54.684 aoe H havoc enemy2 49504.0/50000: 99% mana
0.1/5: 2% soul_shard
4:55.991 havoc O soul_fire Fluffy_Pillow 49157.5/50000: 98% mana
0.3/5: 6% soul_shard
4:59.469 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.8/5: 56% soul_shard
5:00.776 havoc R chaos_bolt Fluffy_Pillow 49156.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
5:02.604 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
5:03.986 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
5:05.814 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
5:08.739 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
5:10.479 aoe F immolate Fluffy_Pillow 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
5:11.786 aoe F immolate enemy3 48905.5/50000: 98% mana
2.5/5: 50% soul_shard
5:13.092 aoe F immolate enemy2 48808.5/50000: 98% mana
2.6/5: 52% soul_shard
5:14.398 aoe J conflagrate Fluffy_Pillow 48711.5/50000: 97% mana
2.8/5: 56% soul_shard
5:15.704 aoe I rain_of_fire Fluffy_Pillow 48864.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
5:17.011 aoe L incinerate Fluffy_Pillow 49518.0/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
5:18.231 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
5:19.972 aoe J conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
1.4/5: 28% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_Kleia_Courage"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=329778/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Kyrian_Pelagos : 9881 dps, 5371 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9881.3 9881.3 17.4 / 0.176% 824.6 / 8.3% 21.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
407.7 404.9 Mana 0.00% 38.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Pelagos 9881
Cataclysm 803 8.1% 9.7 32.32sec 24831 14613 Direct 29.2 6934 13880 8272 19.3%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.73 29.19 0.00 0.00 1.6994 0.0000 241574.45 241574.45 0.00% 14612.54 14612.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 23.54 13 35 6934.46 6143 8485 6933.46 6612 7358 163257 163257 0.00%
crit 19.33% 5.64 0 12 13879.54 12398 16965 13828.95 0 15791 78318 78318 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.79
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1064) 0.0% (10.8%) 11.9 26.16sec 26770 9884

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.95 0.00 178.50 0.00 2.7086 0.1644 0.00 0.00 0.00% 9883.50 9883.50

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.94
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1064 10.8% 0.0 0.00sec 0 0 Direct 535.5 501 1001 597 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 535.49 0.00 0.00 0.0000 0.0000 319830.21 319830.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 432.35 316 563 500.86 267 1141 501.12 473 545 216583 216583 0.00%
crit 19.26% 103.14 63 151 1001.38 535 2282 1001.66 865 1156 103247 103247 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1215 (1625) 12.3% (16.4%) 18.9 15.36sec 25846 12996 Direct 37.6 (74.2) 0 9703 9703 100.0% (60.1%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.88 37.61 0.00 0.00 1.9887 0.0000 364911.08 364911.08 0.00% 12996.41 12996.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.61 26 54 9702.85 6022 14305 9705.46 9234 10206 364911 364911 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.98
  • if_expr:cast_time<havoc_remains
    Internal Combustion 410 4.1% 36.6 15.48sec 3360 0 Direct 36.6 2818 5647 3359 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.63 36.62 0.00 0.00 0.0000 0.0000 123064.95 123064.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.85% 29.61 19 43 2818.22 1 4457 2820.91 2497 3242 83422 83422 0.00%
crit 19.15% 7.01 1 15 5647.28 5 8904 5662.15 3329 7312 39643 39643 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 846 8.6% 37.0 7.96sec 6870 5497 Direct 55.1 3861 7752 4612 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.98 55.08 0.00 0.00 1.2497 0.0000 254049.22 254049.22 0.00% 5497.12 5497.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 44.45 29 60 3861.39 2070 5892 3861.60 3581 4201 171607 171607 0.00%
crit 19.30% 10.63 4 22 7752.09 4204 11785 7767.78 5495 9570 82443 82443 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.88
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.09
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1695 17.2% 25.5 11.42sec 19978 15863 Direct 31.8 1633 3267 1952 19.5%
Periodic 348.0 1078 2158 1287 19.3% 95.7%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.52 31.79 347.96 347.96 1.2595 2.4833 509843.84 509843.84 0.00% 568.87 15862.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.54% 25.60 16 36 1633.43 841 2357 1634.62 1495 1795 41825 41825 0.00%
crit 19.46% 6.19 0 16 3266.59 1682 4713 3252.70 0 4595 20198 20198 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 280.71 207 353 1078.14 0 1473 1078.41 1054 1110 302664 302664 0.00%
crit 19.33% 67.25 39 99 2158.39 1 2946 2158.43 2029 2277 145157 145157 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.77
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.84
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 587 6.0% 39.6 7.11sec 4472 3173 Direct 50.3 (50.3) 2959 5920 3518 18.9% (18.9%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.58 50.33 0.00 0.00 1.4097 0.0000 177032.98 177032.98 0.00% 3172.58 3172.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.11% 40.82 26 60 2958.85 1367 4004 2959.68 2751 3274 120767 120767 0.00%
crit 18.89% 9.51 2 21 5920.01 2700 8007 5920.96 4165 7373 56266 56266 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:28.73
    havoc
    [S]:11.07
  • if_expr:cast_time<havoc_remains
Rain of Fire 1025 10.4% 18.5 15.75sec 16643 13403 Periodic 439.3 588 1175 702 19.4% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.52 0.00 0.00 439.26 1.2417 0.0000 308194.15 308194.15 0.00% 13403.24 13403.24
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.60% 354.06 231 484 587.68 511 700 587.60 575 604 208051 208051 0.00%
crit 19.40% 85.20 46 132 1175.46 1023 1400 1175.37 1137 1228 100143 100143 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.52
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.98
Scouring Tithe 339 3.4% 13.4 22.47sec 7578 4508 Direct 18.8 1523 3031 1813 19.3%
Periodic 134.0 424 848 505 19.1% 36.4%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.44 18.84 133.95 133.95 1.6810 2.4571 101876.35 101876.35 0.00% 289.65 4508.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 15.19 9 23 1523.25 1013 1719 1524.05 1406 1719 23139 23139 0.00%
crit 19.34% 3.64 0 10 3031.32 2045 3437 2982.54 0 3437 11052 11052 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.86% 108.32 65 148 424.13 126 430 424.11 421 427 45940 45940 0.00%
crit 19.14% 25.63 10 42 848.28 253 859 848.34 805 859 21745 21745 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:6.72
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.80
Soul Fire 496 5.0% 5.6 49.39sec 26866 7726 Direct 7.5 16849 33797 20005 18.8%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.56 7.45 0.00 0.00 3.4775 0.0000 149326.25 149326.25 0.00% 7725.90 7725.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.23% 6.05 2 10 16848.80 8828 24728 16906.43 13717 20883 102020 102020 0.00%
crit 18.77% 1.40 0 5 33797.01 17836 49474 26258.03 0 48758 47306 47306 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.73
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.93
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.8% 2.0 180.72sec 12165 10518 Direct 6.0 3423 6845 4050 18.5%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24329.16 24329.16 0.00% 10518.45 10518.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.53% 4.89 1 6 3422.52 3408 3437 3422.51 3408 3437 16741 16741 0.00%
crit 18.47% 1.11 0 5 6845.20 6815 6875 4738.91 0 6875 7588 7588 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3925 / 793
Immolation 3653 7.4% 39.0 5.50sec 5621 0 Direct 117.0 1571 3131 1874 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 219216.37 219216.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.60% 94.31 80 105 1571.03 1432 2077 1571.02 1539 1600 148158 148158 0.00%
crit 19.40% 22.69 12 37 3131.16 2865 4154 3130.61 2880 3416 71059 71059 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 271 0.5% 41.0 5.26sec 397 277 Direct 41.0 334 668 397 18.9%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16288.96 23267.15 29.99% 276.53 276.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.13% 33.26 25 40 334.23 334 334 334.23 334 334 11118 15881 29.99%
crit 18.87% 7.74 1 16 668.47 668 668 668.47 668 668 5171 7386 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 527 / 527
Firebolt 527 5.3% 93.6 3.21sec 1693 1163 Direct 92.9 1432 2863 1705 19.1%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.58 92.89 0.00 0.00 1.4562 0.0000 158421.47 158421.47 0.00% 1162.51 1162.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 75.13 52 96 1431.66 1395 1432 1431.65 1430 1432 107559 107559 0.00%
crit 19.12% 17.76 6 30 2863.22 2790 2865 2863.21 2854 2865 50862 50862 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:94.02
Simple Action Stats Execute Interval
Kyrian_Pelagos
Havoc 9.7 32.16sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.67 0.00 0.00 0.00 1.2444 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.67
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.0 0.0 8.0sec 8.0sec 4.4sec 54.59% 0.00% 0.0 (0.0) 3.1

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.6s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.59%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combat Meditation 4.8 0.0 67.6sec 67.6sec 18.5sec 29.52% 0.00% 28.0 (28.0) 4.6

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_combat_meditation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Stat Details

  • stat:mastery_rating
  • amount:350.00

Trigger Details

  • interval_min/max:60.4s / 82.7s
  • trigger_min/max:60.4s / 82.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.0s

Stack Uptimes

  • combat_meditation_1:29.52%

Spelldata

  • id:328908
  • name:Combat Meditation
  • tooltip:Mastery increased by $w.
  • description:{$@spelldesc328266=$?a137005[Shackle the Unworthy]?a212611[Elysian Decree]?a137009[Kindred Spirits]?a137014[Resonating Arrow]?a137018[Radiant Spark]?a137022[Weapons of Order]?a137026[Divine Toll]?a137030[Boon of the Ascended]?a137034[Echoing Reprimand]?a137038[Vesper Totem]?a137042[Scouring Tithe]?a137047[Spear of Bastion][Activating your Kyrian class ability] increases your Mastery by $328908m1 for ${{$328908d=10 seconds}*$<mod>}.1 sec and occasionally expels Sorrowful Memories. Walking through Sorrowful Memories extends this effect by ${$328913m2*$<mod>}.1 sec. $?a137018|?a137034[Combat Meditation may only occur once every {$345861d=60 seconds}.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Let Go of the Past 1.4 129.0 184.8sec 2.3sec 221.0sec 99.94% 0.00% 126.3 (126.3) 0.4

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_let_go_of_the_past
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:17.1s / 351.5s
  • trigger_min/max:0.9s / 8.7s
  • trigger_pct:100.00%
  • duration_min/max:0.9s / 359.8s

Stack Uptimes

  • let_go_of_the_past_1:0.77%
  • let_go_of_the_past_2:0.99%
  • let_go_of_the_past_3:98.19%

Spelldata

  • id:328900
  • name:Let Go of the Past
  • tooltip:Versatility increased by $w%.
  • description:{$@spelldesc328257=Using a spell or ability increases your Versatility by {$328900s1=1}% for {$328900d=6 seconds}. Using another spell or ability increases this amount by {$328900s1=1}% when it is not a repeat of the previous spell or ability, stacking to {$328900u=3}%.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.6s
  • trigger_min/max:180.0s / 186.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.6s
  • trigger_min/max:180.0s / 186.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.93% 7.93% 14.49% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Pelagos
soul_fire Soul Shard 6.57 6.92 7.32% 1.05 0.57 7.57%
immolate Soul Shard 347.92 33.50 35.40% 0.10 1.30 3.73%
incinerate Soul Shard 39.59 10.09 10.66% 0.25 0.03 0.34%
conflagrate Soul Shard 36.97 27.53 29.09% 0.74 0.00 0.00%
mana_regen Mana 661.67 121862.11 100.00% 184.17 28332.96 18.86%
immolate_crits Soul Shard 33.54 3.23 3.41% 0.10 0.13 3.74%
incinerate_crits Soul Shard 9.51 0.95 1.00% 0.10 0.00 0.23%
infernal Soul Shard 120.00 10.30 10.88% 0.09 1.70 14.19%
souring_tithe Soul Shard 1.01 2.11 2.23% 2.09 2.93 58.12%
pet - imp
energy_regen Energy 362.19 3571.98 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 404.88 407.69 28344.6 49152.3 47632.5 50000.0
Soul Shard 4.0 0.31 0.31 6.7 4.3 0.0 5.0
Usage Type Count Total Avg RPE APR
Kyrian_Pelagos
cataclysm Mana 9.7 4867.8 500.0 500.3 49.6
channel_demonfire Mana 11.9 8955.7 750.0 749.6 35.7
chaos_bolt Soul Shard 18.9 37.8 2.0 2.0 12924.0
conflagrate Mana 37.0 18483.7 500.0 499.8 13.7
havoc Mana 9.7 9671.9 1000.0 1000.2 0.0
immolate Mana 25.5 19136.1 750.0 749.8 26.6
incinerate Mana 39.6 39591.0 1000.0 1000.2 4.5
rain_of_fire Soul Shard 18.5 55.5 3.0 3.0 5552.8
scouring_tithe Mana 13.4 13435.5 1000.0 999.4 7.6
soul_fire Mana 6.6 6567.7 1000.0 1181.6 22.7
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.2
pet - imp
firebolt Energy 93.6 3742.8 40.0 40.0 42.3

Statistics & Data Analysis

Fight Length
Kyrian_Pelagos Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
Kyrian_Pelagos Damage Per Second
Count 627
Mean 9881.30
Minimum 9421.26
Maximum 10559.24
Spread ( max - min ) 1137.98
Range [ ( max - min ) / 2 * 100% ] 5.76%
Standard Deviation 221.7373
5th Percentile 9550.63
95th Percentile 10272.02
( 95th Percentile - 5th Percentile ) 721.38
Mean Distribution
Standard Deviation 8.8553
95.00% Confidence Interval ( 9863.95 - 9898.66 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1935
0.1 Scale Factor Error with Delta=300 420
0.05 Scale Factor Error with Delta=300 1679
0.01 Scale Factor Error with Delta=300 41973
Priority Target DPS
Kyrian_Pelagos Priority Target Damage Per Second
Count 627
Mean 5370.50
Minimum 5064.74
Maximum 5772.34
Spread ( max - min ) 707.60
Range [ ( max - min ) / 2 * 100% ] 6.59%
Standard Deviation 132.1163
5th Percentile 5166.31
95th Percentile 5600.37
( 95th Percentile - 5th Percentile ) 434.07
Mean Distribution
Standard Deviation 5.2762
95.00% Confidence Interval ( 5360.16 - 5380.84 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2325
0.1 Scale Factor Error with Delta=300 150
0.05 Scale Factor Error with Delta=300 597
0.01 Scale Factor Error with Delta=300 14901
DPS(e)
Kyrian_Pelagos Damage Per Second (Effective)
Count 627
Mean 9881.30
Minimum 9421.26
Maximum 10559.24
Spread ( max - min ) 1137.98
Range [ ( max - min ) / 2 * 100% ] 5.76%
Damage
Kyrian_Pelagos Damage
Count 627
Mean 2574032.64
Minimum 2060375.41
Maximum 3096303.06
Spread ( max - min ) 1035927.65
Range [ ( max - min ) / 2 * 100% ] 20.12%
DTPS
Kyrian_Pelagos Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Pelagos Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Pelagos Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Pelagos Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Pelagos Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Pelagos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_PelagosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Pelagos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.73 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.79 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.52 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.94 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.77 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.67 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.98 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.88 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 6.72 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 28.73 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.09 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.93 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.80 scouring_tithe
Q 7.84 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.98 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 11.07 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFEDLFFJKLDJLJADLEHNRSSNOPIFLJEILJLALLHNPRRNQEIFLJLLKL9AHRNRNRQPEJLFFIFJLLLAHNPRRNQ9EIFJLKIJLLAHNRSSRQNEKLFMDFJLD9AHNPRNRRNDFFEFLJKILJLAHSRSNQRP9EFIFJLJLIAHPSNRNRQEFJLFLIKJLLLA9EHRNPRNQIFLJLLE

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.739 aoe E channel_demonfire Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, let_go_of_the_past(2)
0:04.053 cds M summon_infernal Fluffy_Pillow 49776.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, let_go_of_the_past(2)
0:05.057 aoe H havoc enemy2 49278.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, let_go_of_the_past(3)
0:06.064 havoc P scouring_tithe Fluffy_Pillow 48782.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, let_go_of_the_past(3)
0:07.405 havoc R chaos_bolt Fluffy_Pillow 48452.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust, let_go_of_the_past(3), combat_meditation
0:09.414 havoc N conflagrate Fluffy_Pillow 49457.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, let_go_of_the_past(3), combat_meditation
0:10.422 havoc R chaos_bolt Fluffy_Pillow 49461.0/50000: 99% mana
4.6/5: 92% soul_shard
bloodlust, backdraft, let_go_of_the_past(3), combat_meditation
0:11.829 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, let_go_of_the_past(3), combat_meditation
0:12.836 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, let_go_of_the_past(3), combat_meditation
0:13.843 havoc R chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.7/5: 94% soul_shard
bloodlust, backdraft, let_go_of_the_past(3), combat_meditation
0:15.250 havoc N conflagrate Fluffy_Pillow 49956.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, let_go_of_the_past(3), combat_meditation
0:16.255 aoe D rain_of_fire Fluffy_Pillow 49958.5/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, let_go_of_the_past(3), combat_meditation
0:17.261 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
bloodlust, backdraft, let_go_of_the_past(3), combat_meditation
0:18.267 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.2/5: 44% soul_shard
bloodlust, backdraft, let_go_of_the_past(3), combat_meditation
0:20.712 aoe D rain_of_fire Fluffy_Pillow 49724.5/50000: 99% mana
3.1/5: 62% soul_shard
bloodlust, backdraft, let_go_of_the_past(3), combat_meditation
0:21.718 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
bloodlust, backdraft, let_go_of_the_past(3), combat_meditation
0:22.657 aoe F immolate enemy2 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
bloodlust, let_go_of_the_past(3), combat_meditation
0:23.664 aoe F immolate Fluffy_Pillow 48755.5/50000: 98% mana
1.2/5: 24% soul_shard
bloodlust, let_go_of_the_past(3), combat_meditation
0:24.672 aoe J conflagrate Fluffy_Pillow 48509.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, let_go_of_the_past(3), combat_meditation
0:25.678 aoe K scouring_tithe Fluffy_Pillow 48512.5/50000: 97% mana
2.5/5: 50% soul_shard
bloodlust, backdraft, let_go_of_the_past(3), combat_meditation
0:27.019 aoe L incinerate Fluffy_Pillow 48183.0/50000: 96% mana
3.0/5: 60% soul_shard
bloodlust, backdraft, let_go_of_the_past(3)
0:27.959 aoe D rain_of_fire Fluffy_Pillow 47653.0/50000: 95% mana
3.7/5: 74% soul_shard
bloodlust, let_go_of_the_past(3)
0:28.966 aoe J conflagrate Fluffy_Pillow 48156.5/50000: 96% mana
0.9/5: 18% soul_shard
bloodlust, let_go_of_the_past(3)
0:29.973 aoe L incinerate Fluffy_Pillow 48160.0/50000: 96% mana
1.9/5: 38% soul_shard
bloodlust, backdraft, let_go_of_the_past(3)
0:30.913 aoe J conflagrate Fluffy_Pillow 47630.0/50000: 95% mana
2.3/5: 46% soul_shard
bloodlust, let_go_of_the_past(3)
0:31.920 default A cataclysm Fluffy_Pillow 47633.5/50000: 95% mana
3.3/5: 66% soul_shard
bloodlust, backdraft, let_go_of_the_past(3)
0:33.260 aoe D rain_of_fire Fluffy_Pillow 47803.5/50000: 96% mana
3.6/5: 72% soul_shard
bloodlust, backdraft, let_go_of_the_past(3)
0:34.268 aoe L incinerate Fluffy_Pillow 48307.5/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust, backdraft, let_go_of_the_past(3)
0:35.207 aoe E channel_demonfire Fluffy_Pillow 47777.0/50000: 96% mana
1.3/5: 26% soul_shard
bloodlust, let_go_of_the_past(3)
0:37.473 aoe H havoc enemy2 48160.0/50000: 96% mana
1.6/5: 32% soul_shard
bloodlust, let_go_of_the_past(3)
0:38.478 havoc N conflagrate Fluffy_Pillow 47662.5/50000: 95% mana
1.9/5: 38% soul_shard
bloodlust, let_go_of_the_past(3)
0:39.486 havoc R chaos_bolt Fluffy_Pillow 47666.5/50000: 95% mana
2.9/5: 58% soul_shard
bloodlust, backdraft, let_go_of_the_past(3)
0:40.891 havoc S incinerate Fluffy_Pillow 48369.0/50000: 97% mana
1.2/5: 24% soul_shard
bloodlust, let_go_of_the_past(3)
0:42.231 havoc S incinerate Fluffy_Pillow 48039.0/50000: 96% mana
1.9/5: 38% soul_shard
let_go_of_the_past(3)
0:43.971 havoc N conflagrate Fluffy_Pillow 47909.0/50000: 96% mana
2.4/5: 48% soul_shard
let_go_of_the_past(3)
0:45.279 havoc O soul_fire Fluffy_Pillow 48063.0/50000: 96% mana
3.7/5: 74% soul_shard
backdraft, let_go_of_the_past(3)
0:48.758 havoc P scouring_tithe Fluffy_Pillow 48802.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, let_go_of_the_past(3)
0:50.500 aoe I rain_of_fire Fluffy_Pillow 48673.5/50000: 97% mana
5.0/5: 100% soul_shard
backdraft, let_go_of_the_past(3)
0:51.806 aoe F immolate enemy3 49326.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft, let_go_of_the_past(3)
0:53.113 aoe L incinerate Fluffy_Pillow 49230.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, let_go_of_the_past(3)
0:54.333 aoe J conflagrate Fluffy_Pillow 48840.0/50000: 98% mana
2.5/5: 50% soul_shard
let_go_of_the_past(3)
0:55.641 aoe E channel_demonfire Fluffy_Pillow 48994.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, let_go_of_the_past(3)
0:58.503 aoe I rain_of_fire Fluffy_Pillow 49675.0/50000: 99% mana
3.7/5: 74% soul_shard
backdraft, let_go_of_the_past(3)
0:59.809 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, let_go_of_the_past(3)
1:01.029 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
let_go_of_the_past(3)
1:02.336 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.8/5: 36% soul_shard
backdraft, let_go_of_the_past(3)
1:03.555 default A cataclysm Fluffy_Pillow 48765.5/50000: 98% mana
2.4/5: 48% soul_shard
let_go_of_the_past(3)
1:05.296 aoe L incinerate Fluffy_Pillow 49136.0/50000: 98% mana
2.6/5: 52% soul_shard
let_go_of_the_past(3)
1:07.035 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
2.9/5: 58% soul_shard
let_go_of_the_past(3)
1:08.776 aoe H havoc enemy2 48872.0/50000: 98% mana
3.4/5: 68% soul_shard
let_go_of_the_past(3)
1:10.083 havoc N conflagrate Fluffy_Pillow 48525.5/50000: 97% mana
3.4/5: 68% soul_shard
let_go_of_the_past(3)
1:11.389 havoc P scouring_tithe Fluffy_Pillow 48678.5/50000: 97% mana
4.7/5: 94% soul_shard
backdraft, let_go_of_the_past(3)
1:13.129 havoc R chaos_bolt Fluffy_Pillow 48548.5/50000: 97% mana
4.9/5: 98% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
1:14.957 havoc R chaos_bolt Fluffy_Pillow 49462.5/50000: 99% mana
3.0/5: 60% soul_shard
let_go_of_the_past(3), combat_meditation
1:17.566 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
let_go_of_the_past(3), combat_meditation
1:19.085 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
1:20.392 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
1:23.252 aoe I rain_of_fire Fluffy_Pillow 49932.5/50000: 100% mana
3.1/5: 62% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
1:24.559 aoe F immolate enemy3 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
1:25.865 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.4/5: 8% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
1:27.083 aoe J conflagrate Fluffy_Pillow 48861.0/50000: 98% mana
0.7/5: 14% soul_shard
let_go_of_the_past(3), combat_meditation
1:28.389 aoe L incinerate Fluffy_Pillow 49014.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
1:29.609 aoe L incinerate Fluffy_Pillow 48624.0/50000: 97% mana
1.7/5: 34% soul_shard
let_go_of_the_past(3), combat_meditation
1:31.350 aoe K scouring_tithe Fluffy_Pillow 48494.5/50000: 97% mana
2.2/5: 44% soul_shard
let_go_of_the_past(3), combat_meditation
1:33.092 aoe L incinerate Fluffy_Pillow 48365.5/50000: 97% mana
2.3/5: 46% soul_shard
let_go_of_the_past(3)
1:34.831 default 9 soul_fire Fluffy_Pillow 48235.0/50000: 96% mana
2.9/5: 58% soul_shard
let_go_of_the_past(3)
1:38.307 default A cataclysm Fluffy_Pillow 48973.0/50000: 98% mana
4.2/5: 84% soul_shard
let_go_of_the_past(3)
1:40.046 aoe H havoc enemy2 49342.5/50000: 99% mana
4.6/5: 92% soul_shard
let_go_of_the_past(3)
1:41.353 havoc R chaos_bolt Fluffy_Pillow 48996.0/50000: 98% mana
4.6/5: 92% soul_shard
let_go_of_the_past(3)
1:43.963 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
let_go_of_the_past(3)
1:45.270 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft, let_go_of_the_past(3)
1:47.096 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
let_go_of_the_past(3)
1:48.403 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft, let_go_of_the_past(3)
1:50.232 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
let_go_of_the_past(3)
1:51.537 havoc P scouring_tithe Fluffy_Pillow 49251.5/50000: 99% mana
1.8/5: 36% soul_shard
let_go_of_the_past(3)
1:53.279 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
2.0/5: 40% soul_shard
let_go_of_the_past(3)
1:56.104 aoe J conflagrate Fluffy_Pillow 49665.5/50000: 99% mana
2.3/5: 46% soul_shard
let_go_of_the_past(3)
1:57.410 aoe L incinerate Fluffy_Pillow 49818.5/50000: 100% mana
3.0/5: 60% soul_shard
backdraft, let_go_of_the_past(3)
1:58.628 aoe F immolate enemy3 49001.5/50000: 98% mana
3.3/5: 66% soul_shard
let_go_of_the_past(3)
1:59.935 aoe F immolate enemy2 48905.0/50000: 98% mana
3.4/5: 68% soul_shard
let_go_of_the_past(3)
2:01.241 aoe I rain_of_fire Fluffy_Pillow 48808.0/50000: 98% mana
3.6/5: 72% soul_shard
let_go_of_the_past(3)
2:02.548 aoe F immolate Fluffy_Pillow 49461.5/50000: 99% mana
0.7/5: 14% soul_shard
let_go_of_the_past(3)
2:03.853 aoe J conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
0.9/5: 18% soul_shard
let_go_of_the_past(3)
2:05.160 aoe L incinerate Fluffy_Pillow 49405.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft, let_go_of_the_past(3)
2:06.379 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
let_go_of_the_past(3)
2:08.119 aoe L incinerate Fluffy_Pillow 48872.0/50000: 98% mana
2.4/5: 48% soul_shard
let_go_of_the_past(3)
2:09.861 default A cataclysm Fluffy_Pillow 48743.0/50000: 97% mana
2.8/5: 56% soul_shard
let_go_of_the_past(3)
2:11.784 aoe H havoc enemy2 49204.5/50000: 98% mana
3.0/5: 60% soul_shard
let_go_of_the_past(3)
2:13.090 havoc N conflagrate Fluffy_Pillow 48857.5/50000: 98% mana
3.3/5: 66% soul_shard
let_go_of_the_past(3)
2:14.396 havoc P scouring_tithe Fluffy_Pillow 49010.5/50000: 98% mana
4.4/5: 88% soul_shard
backdraft, let_go_of_the_past(3)
2:16.135 havoc R chaos_bolt Fluffy_Pillow 48880.0/50000: 98% mana
4.6/5: 92% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
2:17.962 havoc R chaos_bolt Fluffy_Pillow 49793.5/50000: 100% mana
2.9/5: 58% soul_shard
let_go_of_the_past(3), combat_meditation
2:20.571 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
let_go_of_the_past(3), combat_meditation
2:21.877 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
2:23.184 default 9 soul_fire Fluffy_Pillow 49252.5/50000: 99% mana
2.5/5: 50% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
2:26.782 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
2:29.547 aoe I rain_of_fire Fluffy_Pillow 49635.0/50000: 99% mana
4.6/5: 92% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
2:30.853 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
let_go_of_the_past(3), combat_meditation
2:32.159 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.9/5: 38% soul_shard
let_go_of_the_past(3), combat_meditation
2:33.466 aoe L incinerate Fluffy_Pillow 49405.5/50000: 99% mana
2.5/5: 50% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
2:34.685 aoe K scouring_tithe Fluffy_Pillow 49002.0/50000: 98% mana
2.9/5: 58% soul_shard
let_go_of_the_past(3), combat_meditation
2:36.425 aoe I rain_of_fire Fluffy_Pillow 48872.0/50000: 98% mana
3.1/5: 62% soul_shard
let_go_of_the_past(3)
2:37.729 aoe J conflagrate Fluffy_Pillow 49524.0/50000: 99% mana
0.3/5: 6% soul_shard
let_go_of_the_past(3)
2:39.034 aoe L incinerate Fluffy_Pillow 49676.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft, let_go_of_the_past(3)
2:40.255 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.3/5: 26% soul_shard
let_go_of_the_past(3)
2:41.995 default A cataclysm Fluffy_Pillow 48873.0/50000: 98% mana
1.7/5: 34% soul_shard
let_go_of_the_past(3)
2:43.735 aoe H havoc enemy2 49243.0/50000: 98% mana
1.9/5: 38% soul_shard
let_go_of_the_past(3)
2:45.040 havoc N conflagrate Fluffy_Pillow 48895.5/50000: 98% mana
2.0/5: 40% soul_shard
let_go_of_the_past(3)
2:46.347 havoc R chaos_bolt Fluffy_Pillow 49049.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, let_go_of_the_past(3)
2:48.174 havoc S incinerate Fluffy_Pillow 49962.5/50000: 100% mana
1.4/5: 28% soul_shard
let_go_of_the_past(3)
2:49.915 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
let_go_of_the_past(3)
2:51.657 havoc R chaos_bolt Fluffy_Pillow 48873.5/50000: 98% mana
2.6/5: 52% soul_shard
let_go_of_the_past(3)
2:54.266 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
let_go_of_the_past(3)
2:55.572 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
let_go_of_the_past(3)
2:56.877 aoe E channel_demonfire Fluffy_Pillow 49404.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, let_go_of_the_past(3)
2:59.731 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft, let_go_of_the_past(3)
3:01.472 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, let_go_of_the_past(3)
3:02.691 aoe F immolate enemy3 48612.0/50000: 97% mana
3.2/5: 64% soul_shard
let_go_of_the_past(3)
3:03.998 cds M summon_infernal Fluffy_Pillow 48515.5/50000: 97% mana
3.3/5: 66% soul_shard
let_go_of_the_past(3)
3:05.359 aoe D rain_of_fire Fluffy_Pillow 48196.0/50000: 96% mana
3.7/5: 74% soul_shard
let_go_of_the_past(3)
3:06.666 aoe F immolate enemy2 48849.5/50000: 98% mana
1.2/5: 24% soul_shard
let_go_of_the_past(3)
3:07.970 aoe J conflagrate Fluffy_Pillow 48751.5/50000: 98% mana
1.6/5: 32% soul_shard
let_go_of_the_past(3)
3:09.278 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, let_go_of_the_past(3)
3:10.497 aoe D rain_of_fire Fluffy_Pillow 48515.0/50000: 97% mana
3.1/5: 62% soul_shard
let_go_of_the_past(3)
3:11.804 default 9 soul_fire Fluffy_Pillow 49168.5/50000: 98% mana
0.5/5: 10% soul_shard
let_go_of_the_past(3)
3:15.282 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.7/5: 54% soul_shard
let_go_of_the_past(3)
3:17.022 aoe H havoc enemy2 49372.5/50000: 99% mana
3.1/5: 62% soul_shard
let_go_of_the_past(3)
3:18.328 havoc N conflagrate Fluffy_Pillow 49025.5/50000: 98% mana
3.6/5: 72% soul_shard
let_go_of_the_past(3)
3:19.634 havoc P scouring_tithe Fluffy_Pillow 49178.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, let_go_of_the_past(3)
3:21.375 havoc R chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
3:23.203 havoc N conflagrate Fluffy_Pillow 49916.5/50000: 100% mana
3.0/5: 60% soul_shard
let_go_of_the_past(3), combat_meditation
3:24.511 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
3:26.339 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
let_go_of_the_past(3), combat_meditation
3:28.948 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
let_go_of_the_past(3), combat_meditation
3:30.253 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
3:31.561 aoe F immolate enemy2 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
3:32.868 aoe F immolate Fluffy_Pillow 49252.5/50000: 99% mana
1.0/5: 20% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
3:34.174 aoe E channel_demonfire Fluffy_Pillow 49155.5/50000: 98% mana
1.4/5: 28% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
3:36.980 aoe F immolate enemy3 49808.5/50000: 100% mana
1.7/5: 34% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
3:38.287 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
1.8/5: 36% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
3:39.507 aoe J conflagrate Fluffy_Pillow 48862.5/50000: 98% mana
2.2/5: 44% soul_shard
let_go_of_the_past(3), combat_meditation
3:40.815 aoe K scouring_tithe Fluffy_Pillow 49016.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, let_go_of_the_past(3)
3:42.556 aoe I rain_of_fire Fluffy_Pillow 48887.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, let_go_of_the_past(3)
3:43.861 aoe L incinerate Fluffy_Pillow 49539.5/50000: 99% mana
0.3/5: 6% soul_shard
backdraft, let_go_of_the_past(3)
3:45.081 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
let_go_of_the_past(3)
3:46.387 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft, let_go_of_the_past(3)
3:47.606 default A cataclysm Fluffy_Pillow 48765.0/50000: 98% mana
1.7/5: 34% soul_shard
let_go_of_the_past(3)
3:49.347 aoe H havoc enemy2 49135.5/50000: 98% mana
1.8/5: 36% soul_shard
let_go_of_the_past(3)
3:50.651 havoc S incinerate Fluffy_Pillow 48787.5/50000: 98% mana
2.0/5: 40% soul_shard
let_go_of_the_past(3)
3:52.391 havoc R chaos_bolt Fluffy_Pillow 48657.5/50000: 97% mana
2.6/5: 52% soul_shard
let_go_of_the_past(3)
3:55.001 havoc S incinerate Fluffy_Pillow 49962.5/50000: 100% mana
0.9/5: 18% soul_shard
let_go_of_the_past(3)
3:56.742 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
let_go_of_the_past(3)
3:58.048 havoc Q immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, let_go_of_the_past(3)
3:59.354 havoc R chaos_bolt Fluffy_Pillow 49058.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, let_go_of_the_past(3)
4:01.181 havoc P scouring_tithe Fluffy_Pillow 49972.0/50000: 100% mana
1.2/5: 24% soul_shard
let_go_of_the_past(3)
4:02.922 default 9 soul_fire Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
let_go_of_the_past(3)
4:06.400 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.0/5: 60% soul_shard
let_go_of_the_past(3)
4:09.363 aoe F immolate enemy3 49734.0/50000: 99% mana
3.6/5: 72% soul_shard
let_go_of_the_past(3)
4:10.668 aoe I rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
3.8/5: 76% soul_shard
let_go_of_the_past(3)
4:11.973 aoe F immolate enemy2 49904.0/50000: 100% mana
0.9/5: 18% soul_shard
let_go_of_the_past(3)
4:13.281 aoe J conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.2/5: 24% soul_shard
let_go_of_the_past(3)
4:14.587 aoe L incinerate Fluffy_Pillow 49406.0/50000: 99% mana
1.8/5: 36% soul_shard
backdraft, let_go_of_the_past(3)
4:15.807 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
let_go_of_the_past(3)
4:17.114 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, let_go_of_the_past(3)
4:18.334 aoe I rain_of_fire Fluffy_Pillow 48766.0/50000: 98% mana
3.1/5: 62% soul_shard
let_go_of_the_past(3)
4:19.642 default A cataclysm Fluffy_Pillow 49420.0/50000: 99% mana
0.2/5: 4% soul_shard
let_go_of_the_past(3)
4:21.382 aoe H havoc enemy2 49502.0/50000: 99% mana
0.6/5: 12% soul_shard
let_go_of_the_past(3)
4:22.688 havoc P scouring_tithe Fluffy_Pillow 49155.0/50000: 98% mana
0.7/5: 14% soul_shard
let_go_of_the_past(3)
4:24.427 havoc S incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.9/5: 18% soul_shard
let_go_of_the_past(3), combat_meditation
4:26.166 havoc N conflagrate Fluffy_Pillow 48871.0/50000: 98% mana
1.6/5: 32% soul_shard
let_go_of_the_past(3), combat_meditation
4:27.473 havoc R chaos_bolt Fluffy_Pillow 49024.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
4:29.301 havoc N conflagrate Fluffy_Pillow 49938.5/50000: 100% mana
1.3/5: 26% soul_shard
let_go_of_the_past(3), combat_meditation
4:30.608 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
4:32.436 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
let_go_of_the_past(3), combat_meditation
4:33.745 aoe E channel_demonfire Fluffy_Pillow 49253.5/50000: 99% mana
1.0/5: 20% soul_shard
let_go_of_the_past(3), combat_meditation
4:36.609 aoe F immolate enemy2 49935.5/50000: 100% mana
1.5/5: 30% soul_shard
let_go_of_the_past(3), combat_meditation
4:37.917 aoe J conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.6/5: 32% soul_shard
let_go_of_the_past(3), combat_meditation
4:39.223 aoe L incinerate Fluffy_Pillow 49406.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, let_go_of_the_past(3), combat_meditation
4:40.445 aoe F immolate enemy3 49003.5/50000: 98% mana
2.5/5: 50% soul_shard
let_go_of_the_past(3), combat_meditation
4:41.751 aoe L incinerate Fluffy_Pillow 48906.5/50000: 98% mana
2.7/5: 54% soul_shard
let_go_of_the_past(3), combat_meditation
4:43.491 aoe I rain_of_fire Fluffy_Pillow 48776.5/50000: 98% mana
3.1/5: 62% soul_shard
let_go_of_the_past(3)
4:44.797 aoe K scouring_tithe Fluffy_Pillow 49429.5/50000: 99% mana
0.3/5: 6% soul_shard
let_go_of_the_past(3)
4:46.537 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.4/5: 8% soul_shard
let_go_of_the_past(3)
4:47.845 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.1/5: 22% soul_shard
backdraft, let_go_of_the_past(3)
4:49.066 aoe L incinerate Fluffy_Pillow 48766.5/50000: 98% mana
1.4/5: 28% soul_shard
let_go_of_the_past(3)
4:50.807 aoe L incinerate Fluffy_Pillow 48637.0/50000: 97% mana
2.0/5: 40% soul_shard
let_go_of_the_past(3)
4:52.548 default A cataclysm Fluffy_Pillow 48507.5/50000: 97% mana
2.6/5: 52% soul_shard
let_go_of_the_past(3)
4:54.289 default 9 soul_fire Fluffy_Pillow 48878.0/50000: 98% mana
2.7/5: 54% soul_shard
let_go_of_the_past(3)
4:57.767 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
4.2/5: 84% soul_shard
let_go_of_the_past(3)
5:00.547 aoe H havoc enemy2 49642.5/50000: 99% mana
4.5/5: 90% soul_shard
let_go_of_the_past(3)
5:01.854 havoc R chaos_bolt Fluffy_Pillow 49296.0/50000: 99% mana
4.6/5: 92% soul_shard
let_go_of_the_past(3)
5:04.464 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
let_go_of_the_past(3)
5:05.771 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
backdraft, let_go_of_the_past(3)
5:07.513 havoc R chaos_bolt Fluffy_Pillow 49003.0/50000: 98% mana
4.4/5: 88% soul_shard
backdraft, let_go_of_the_past(3)
5:09.340 havoc N conflagrate Fluffy_Pillow 49916.5/50000: 100% mana
2.6/5: 52% soul_shard
let_go_of_the_past(3)
5:10.647 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.8/5: 76% soul_shard
backdraft, let_go_of_the_past(3)
5:11.954 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.8/5: 76% soul_shard
backdraft, let_go_of_the_past(3)
5:13.258 aoe F immolate enemy3 49904.5/50000: 100% mana
1.0/5: 20% soul_shard
backdraft, let_go_of_the_past(3)
5:14.565 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
1.2/5: 24% soul_shard
backdraft, let_go_of_the_past(3)
5:15.784 aoe J conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
1.6/5: 32% soul_shard
let_go_of_the_past(3)
5:17.089 aoe L incinerate Fluffy_Pillow 49014.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, let_go_of_the_past(3)
5:18.308 aoe L incinerate Fluffy_Pillow 48624.0/50000: 97% mana
2.6/5: 52% soul_shard
let_go_of_the_past(3)
5:20.048 aoe E channel_demonfire Fluffy_Pillow 48494.0/50000: 97% mana
2.9/5: 58% soul_shard
let_go_of_the_past(3)

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_Pelagos"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=328257/328266/infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Necrolord_Emeni : 9913 dps, 5488 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9912.7 9912.7 17.1 / 0.172% 808.1 / 8.2% 20.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
420.9 417.5 Mana 0.00% 38.0 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Emeni 9913
Cataclysm 791 8.0% 9.7 32.43sec 24515 14427 Direct 29.1 6813 13662 8172 19.9%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.71 29.12 0.00 0.00 1.6993 0.0000 237956.70 237956.70 0.00% 14426.86 14426.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.15% 23.34 13 33 6812.88 6142 8348 6812.16 6458 7125 158992 158992 0.00%
crit 19.85% 5.78 0 13 13661.65 12284 16696 13635.01 0 15728 78965 78965 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.77
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1044) 0.0% (10.5%) 12.1 25.76sec 25878 9629

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.13 0.00 181.15 0.00 2.6876 0.1631 0.00 0.00 0.00% 9628.94 9628.94

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.12
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1044 10.5% 0.0 0.00sec 0 0 Direct 543.5 484 967 578 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 543.46 0.00 0.00 0.0000 0.0000 313836.02 313836.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 438.71 314 561 484.48 263 1122 484.91 457 517 212582 212582 0.00%
crit 19.27% 104.75 69 155 967.47 525 2245 966.93 816 1107 101254 101254 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1193 (1586) 12.0% (16.0%) 19.1 15.39sec 25007 12424 Direct 37.9 (75.0) 0 9457 9457 100.0% (60.1%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.06 37.91 0.00 0.00 2.0127 0.0000 358563.54 358563.54 0.00% 12424.33 12424.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.91 28 50 9456.65 5930 14075 9458.58 9168 9738 358564 358564 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:19.13
  • if_expr:cast_time<havoc_remains
    Internal Combustion 393 4.0% 37.1 15.40sec 3177 0 Direct 37.1 2662 5313 3179 19.4%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.14 37.13 0.00 0.00 0.0000 0.0000 117996.44 117996.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 29.92 18 44 2661.90 1 4271 2664.43 2428 3034 79647 79647 0.00%
crit 19.42% 7.21 0 15 5312.67 2 8543 5310.15 0 7411 38349 38349 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 822 8.3% 36.9 7.95sec 6705 5366 Direct 55.4 3741 7503 4463 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.88 55.43 0.00 0.00 1.2495 0.0000 247290.95 247290.95 0.00% 5366.21 5366.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.86% 44.82 32 59 3741.11 2047 5798 3740.75 3522 4046 167706 167706 0.00%
crit 19.14% 10.61 3 19 7502.81 4094 11595 7498.27 5653 9178 79585 79585 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:18.32
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.55
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Decimating Bolt 0 (190) 0.0% (1.9%) 6.4 49.21sec 8866 4226

Stats Details: Decimating Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.45 0.00 0.00 0.00 2.0978 0.0000 0.00 0.00 0.00% 4226.39 4226.39

Action Details: Decimating Bolt

  • id:325289
  • school:shadow
  • range:40.0
  • travel_speed:25.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:325289
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.

Action Priority List

    aoe
    [J]:3.00
  • if_expr:(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
    havoc
    [P]:3.48
  • if_expr:cast_time<havoc_remains&soulbind.lead_by_example.enabled
    Decimating Bolt (_tick_t) 190 1.9% 0.0 0.00sec 0 0 Direct 39.4 1210 2431 1450 19.7%

Stats Details: Decimating Bolt Tick T

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 39.40 0.00 0.00 0.0000 0.0000 57170.36 57170.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.35% 31.66 21 45 1210.07 592 1925 1208.73 1074 1330 38316 38316 0.00%
crit 19.65% 7.74 1 17 2431.16 1185 3849 2432.14 1451 3630 18855 18855 0.00%

Action Details: Decimating Bolt Tick T

  • id:327059
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:327059
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
Immolate 1643 16.6% 25.8 11.09sec 19127 15180 Direct 32.4 1544 3088 1843 19.4%
Periodic 350.2 1042 2083 1241 19.1% 96.4%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.84 32.38 350.16 350.16 1.2601 2.4846 494195.10 494195.10 0.00% 547.53 15179.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 26.09 15 38 1544.12 819 2318 1543.57 1406 1698 40267 40267 0.00%
crit 19.43% 6.29 1 15 3087.64 1640 4637 3088.20 1799 3889 19435 19435 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.89% 283.23 209 357 1041.68 0 1449 1041.80 1022 1061 295047 295047 0.00%
crit 19.11% 66.93 40 100 2083.45 8 2899 2083.45 1968 2189 139446 139446 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:18.04
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.92
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 938 9.5% 43.7 6.40sec 6460 4472 Direct 54.6 (54.6) 4346 8627 5169 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.74 54.62 0.00 0.00 1.4444 0.0000 282596.32 282596.32 0.00% 4472.45 4472.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 44.10 27 64 4345.91 1369 10165 4355.15 3870 5057 191761 191761 0.00%
crit 19.27% 10.52 2 23 8626.65 2782 19974 8645.32 5010 12290 90836 90836 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:32.73
    havoc
    [S]:11.27
  • if_expr:cast_time<havoc_remains
Rain of Fire 994 10.0% 18.7 15.47sec 15973 12858 Periodic 443.5 565 1129 673 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.68 0.00 0.00 443.48 1.2423 0.0000 298445.61 298445.61 0.00% 12857.94 12857.94
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.81% 358.38 257 520 564.65 507 689 564.57 554 578 202360 202360 0.00%
crit 19.19% 85.09 44 139 1129.28 1013 1378 1129.07 1099 1166 96086 96086 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.44
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:12.24
Soul Fire 497 5.0% 5.6 49.49sec 26703 7679 Direct 7.9 15886 31656 18900 19.2%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.61 7.92 0.00 0.00 3.4775 0.0000 149699.34 149699.34 0.00% 7678.86 7678.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 6.40 2 11 15885.53 8600 21174 15929.44 12917 19091 101710 101710 0.00%
crit 19.18% 1.52 0 6 31655.92 17214 42304 25804.71 0 42251 47989 47989 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.29
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.41
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.50sec 12079 10449 Direct 6.0 3348 6696 4023 20.3%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24157.84 24157.84 0.00% 10448.89 10448.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.74% 4.78 2 6 3348.13 3348 3348 3348.13 3348 3348 16020 16020 0.00%
crit 20.26% 1.22 0 4 6696.27 6696 6696 4912.73 0 6696 8138 8138 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3968 / 802
Immolation 3693 7.4% 39.0 5.49sec 5682 0 Direct 117.0 1589 3183 1893 19.1%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 221582.65 221582.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 94.62 78 108 1589.00 1395 2326 1588.95 1549 1623 150342 150342 0.00%
crit 19.13% 22.38 9 39 3182.53 2790 4652 3183.06 2927 3525 71241 71241 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 275 0.6% 41.0 5.25sec 403 280 Direct 41.0 338 676 403 19.2%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16515.37 23590.56 29.99% 280.38 280.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 33.12 22 39 337.85 326 374 337.83 330 344 11188 15981 29.99%
crit 19.23% 7.88 2 19 675.71 651 749 675.62 651 729 5328 7610 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 524 / 524
Firebolt 524 5.3% 93.6 3.21sec 1686 1157 Direct 92.9 1427 2852 1698 19.0%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.58 92.89 0.00 0.00 1.4562 0.0000 157736.10 157736.10 0.00% 1157.49 1157.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.95% 75.20 54 96 1426.51 1395 1604 1426.50 1414 1437 107276 107276 0.00%
crit 19.05% 17.69 5 33 2851.84 2790 3208 2852.44 2790 2962 50460 50460 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:94.02
Simple Action Stats Execute Interval
Necrolord_Emeni
Havoc 9.7 32.20sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.66 0.00 0.00 0.00 1.2444 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.67
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.9 0.0 8.0sec 8.0sec 4.2sec 51.25% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 25.3s
  • trigger_min/max:1.9s / 25.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:51.25%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Decimating Bolt 6.4 3.5 49.2sec 30.1sec 15.0sec 31.90% 0.00% 3.5 (10.4) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_decimating_bolt
  • max_stacks:3
  • base duration:45.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 56.4s
  • trigger_min/max:0.0s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 27.7s

Stack Uptimes

  • decimating_bolt_1:8.24%
  • decimating_bolt_2:9.37%
  • decimating_bolt_3:14.30%

Spelldata

  • id:325299
  • name:Decimating Bolt
  • tooltip:Damage of {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044&!s137046[Demonbolt][Shadow Bolt] increased by $w2%.
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Lead by Example 6.4 0.0 49.3sec 49.3sec 7.4sec 15.85% 0.00% 0.0 (0.0) 6.3

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_lead_by_example
  • max_stacks:1
  • base duration:7.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 56.4s
  • trigger_min/max:47.2s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 7.5s

Stack Uptimes

  • lead_by_example_1:15.85%

Spelldata

  • id:342181
  • name:Lead by Example
  • tooltip:$pri increased by $w1%.
  • description:{$@spelldesc342156=$?a137005[Abomination Limb]?a212611[Fodder to the Flame]?a137009[Adaptive Swarm]?a137014[Death Chakram]?a137018[Deathborne]?a137022[Bonedust Brew]?a137026[Vanquisher's Hammer]?a137030[Unholy Nova]?a137034[Serrated Bone Spike]?a137038[Primordial Wave]?a137042[Decimating Bolt]?a137047[Conqueror's Banner][Activating your Necrolord class ability] increases your $pri by {$342181s2=5}% and nearby allies' primary stat by {$342181s1=2}% for ${{$s3=10}*$<mod>}.1 sec. You gain {$342181s2=5}% additional $pri for each ally affected, up to ${({$342181s3=3}*{$342181s2=5})}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.2s
  • trigger_min/max:180.0s / 182.2s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.2s
  • trigger_min/max:180.0s / 182.2s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 8.83% 5.82% 12.16% 0.7s 0.0s 5.5s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Emeni
soul_fire Soul Shard 6.62 7.26 7.77% 1.10 0.75 9.35%
immolate Soul Shard 350.10 33.43 35.76% 0.10 1.58 4.52%
incinerate Soul Shard 43.77 10.99 11.75% 0.25 0.01 0.08%
conflagrate Soul Shard 36.87 27.71 29.64% 0.75 0.00 0.00%
mana_regen Mana 687.28 125673.98 100.00% 182.86 24528.57 16.33%
immolate_crits Soul Shard 33.54 3.20 3.42% 0.10 0.16 4.66%
incinerate_crits Soul Shard 10.51 1.05 1.12% 0.10 0.00 0.19%
infernal Soul Shard 120.00 9.84 10.53% 0.08 2.16 17.98%
pet - imp
energy_regen Energy 362.19 3571.98 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 417.51 420.88 24548.4 48986.2 46825.0 50000.0
Soul Shard 4.0 0.31 0.31 4.7 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
Necrolord_Emeni
cataclysm Mana 9.7 4856.9 500.0 500.4 49.0
channel_demonfire Mana 12.1 9089.8 750.0 749.5 34.5
chaos_bolt Soul Shard 19.0 38.1 2.0 2.0 12513.4
conflagrate Mana 36.9 18434.7 500.0 499.9 13.4
decimating_bolt Mana 6.4 12886.5 2000.0 1998.5 4.4
havoc Mana 9.7 9665.6 1000.0 1000.2 0.0
immolate Mana 25.8 19378.7 750.0 750.0 25.5
incinerate Mana 43.8 43765.2 1000.0 1000.5 6.5
rain_of_fire Soul Shard 18.7 56.0 3.0 3.0 5325.2
soul_fire Mana 6.6 6615.9 1000.0 1180.1 22.6
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 93.6 3742.8 40.0 40.0 42.1

Statistics & Data Analysis

Fight Length
Necrolord_Emeni Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
Necrolord_Emeni Damage Per Second
Count 627
Mean 9912.71
Minimum 9443.37
Maximum 10594.59
Spread ( max - min ) 1151.22
Range [ ( max - min ) / 2 * 100% ] 5.81%
Standard Deviation 218.3042
5th Percentile 9580.17
95th Percentile 10277.45
( 95th Percentile - 5th Percentile ) 697.28
Mean Distribution
Standard Deviation 8.7182
95.00% Confidence Interval ( 9895.62 - 9929.80 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1864
0.1 Scale Factor Error with Delta=300 407
0.05 Scale Factor Error with Delta=300 1628
0.01 Scale Factor Error with Delta=300 40683
Priority Target DPS
Necrolord_Emeni Priority Target Damage Per Second
Count 627
Mean 5488.06
Minimum 5136.27
Maximum 5912.39
Spread ( max - min ) 776.12
Range [ ( max - min ) / 2 * 100% ] 7.07%
Standard Deviation 130.7361
5th Percentile 5282.86
95th Percentile 5708.90
( 95th Percentile - 5th Percentile ) 426.04
Mean Distribution
Standard Deviation 5.2211
95.00% Confidence Interval ( 5477.82 - 5498.29 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2180
0.1 Scale Factor Error with Delta=300 146
0.05 Scale Factor Error with Delta=300 584
0.01 Scale Factor Error with Delta=300 14591
DPS(e)
Necrolord_Emeni Damage Per Second (Effective)
Count 627
Mean 9912.71
Minimum 9443.37
Maximum 10594.59
Spread ( max - min ) 1151.22
Range [ ( max - min ) / 2 * 100% ] 5.81%
Damage
Necrolord_Emeni Damage
Count 627
Mean 2581908.22
Minimum 2012623.71
Maximum 3136557.78
Spread ( max - min ) 1123934.07
Range [ ( max - min ) / 2 * 100% ] 21.77%
DTPS
Necrolord_Emeni Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Emeni Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Emeni Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Emeni Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Emeni Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Emeni Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_EmeniTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Emeni Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.29 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.77 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.44 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.12 channel_demonfire,if=dot.immolate.remains>cast_time
F 18.04 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.67 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 12.24 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
J 3.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 18.32 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 32.73 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.55 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.41 soul_fire,if=cast_time<havoc_remains
P 3.48 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
Q 7.92 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 19.13 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 11.27 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFELDFFKLKDLKLADLEHNRSRONFFIJEKLIAKLLHNRSSQNSEFILKILLLA9HNPRNRSQEFFIKLKLLAIKHSRSSNQE9FIJKILKALHRSSNQRNELFIKLMFFLDAHNOPRNDELDKFLFFIKLLAHNRSRSNQEFLF9IJKLIAHSNRSNRNEFFLFIKLLLLKAHROPRNEILKFLFFIKLLA

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.939 cds M summon_infernal Fluffy_Pillow 49719.5/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.946 aoe H havoc enemy2 49223.0/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.951 havoc P decimating_bolt Fluffy_Pillow 48725.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.626 havoc R chaos_bolt Fluffy_Pillow 47563.0/50000: 95% mana
5.0/5: 100% soul_shard
bloodlust, lead_by_example
0:09.634 havoc N conflagrate Fluffy_Pillow 48567.0/50000: 97% mana
3.0/5: 60% soul_shard
bloodlust, decimating_bolt(3), lead_by_example
0:10.640 havoc R chaos_bolt Fluffy_Pillow 48570.0/50000: 97% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, decimating_bolt(3), lead_by_example
0:12.045 havoc N conflagrate Fluffy_Pillow 49272.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, decimating_bolt(3), lead_by_example
0:13.051 havoc Q immolate Fluffy_Pillow 49275.5/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, decimating_bolt(3), lead_by_example
0:14.058 havoc R chaos_bolt Fluffy_Pillow 49029.0/50000: 98% mana
4.8/5: 96% soul_shard
bloodlust, backdraft, decimating_bolt(3), lead_by_example
0:15.466 havoc N conflagrate Fluffy_Pillow 49733.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, decimating_bolt(3)
0:16.473 aoe D rain_of_fire Fluffy_Pillow 49736.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:17.478 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:18.483 aoe E channel_demonfire Fluffy_Pillow 49251.5/50000: 99% mana
2.2/5: 44% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:20.740 aoe L incinerate Fluffy_Pillow 49630.0/50000: 99% mana
2.9/5: 58% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:21.679 aoe D rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.3/5: 66% soul_shard
bloodlust, decimating_bolt(2)
0:22.684 aoe F immolate enemy2 49504.5/50000: 99% mana
0.8/5: 16% soul_shard
bloodlust, decimating_bolt(2)
0:23.691 aoe F immolate Fluffy_Pillow 49252.5/50000: 99% mana
1.0/5: 20% soul_shard
bloodlust, decimating_bolt(2)
0:24.697 aoe K conflagrate Fluffy_Pillow 49005.5/50000: 98% mana
1.5/5: 30% soul_shard
bloodlust, decimating_bolt(2)
0:25.704 aoe L incinerate Fluffy_Pillow 49009.0/50000: 98% mana
2.2/5: 44% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:26.642 aoe K conflagrate Fluffy_Pillow 48478.0/50000: 97% mana
2.9/5: 58% soul_shard
bloodlust, decimating_bolt
0:27.648 aoe D rain_of_fire Fluffy_Pillow 48481.0/50000: 97% mana
3.6/5: 72% soul_shard
bloodlust, backdraft, decimating_bolt
0:28.654 aoe L incinerate Fluffy_Pillow 48984.0/50000: 98% mana
1.1/5: 22% soul_shard
bloodlust, backdraft, decimating_bolt
0:29.594 aoe K conflagrate Fluffy_Pillow 48454.0/50000: 97% mana
1.5/5: 30% soul_shard
bloodlust
0:30.602 aoe L incinerate Fluffy_Pillow 48458.0/50000: 97% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:31.541 default A cataclysm Fluffy_Pillow 47927.5/50000: 96% mana
2.9/5: 58% soul_shard
bloodlust
0:33.078 aoe D rain_of_fire Fluffy_Pillow 48196.0/50000: 96% mana
3.5/5: 70% soul_shard
bloodlust
0:34.085 aoe L incinerate Fluffy_Pillow 48699.5/50000: 97% mana
1.0/5: 20% soul_shard
bloodlust
0:35.427 aoe E channel_demonfire Fluffy_Pillow 48370.5/50000: 97% mana
1.3/5: 26% soul_shard
bloodlust
0:37.623 aoe H havoc enemy2 48718.5/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust
0:38.630 havoc N conflagrate Fluffy_Pillow 48222.0/50000: 96% mana
2.0/5: 40% soul_shard
bloodlust
0:39.636 havoc R chaos_bolt Fluffy_Pillow 48225.0/50000: 96% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:41.043 havoc S incinerate Fluffy_Pillow 48928.5/50000: 98% mana
1.3/5: 26% soul_shard
0:42.783 havoc R chaos_bolt Fluffy_Pillow 48798.5/50000: 98% mana
2.0/5: 40% soul_shard
0:45.390 havoc O soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
0:48.868 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.9/5: 58% soul_shard
0:50.176 aoe F immolate Fluffy_Pillow 49156.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
0:51.481 aoe F immolate enemy3 49059.0/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
0:52.789 aoe I rain_of_fire Fluffy_Pillow 48963.0/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
0:54.098 aoe J decimating_bolt Fluffy_Pillow 49617.5/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
0:56.274 aoe E channel_demonfire Fluffy_Pillow 48002.5/50000: 96% mana
1.7/5: 34% soul_shard
backdraft, lead_by_example
0:59.092 aoe K conflagrate Fluffy_Pillow 48661.5/50000: 97% mana
2.0/5: 40% soul_shard
decimating_bolt(3), lead_by_example
1:00.397 aoe L incinerate Fluffy_Pillow 48814.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, decimating_bolt(3), lead_by_example
1:01.617 aoe I rain_of_fire Fluffy_Pillow 48424.0/50000: 97% mana
3.0/5: 60% soul_shard
decimating_bolt(2), lead_by_example
1:02.922 default A cataclysm Fluffy_Pillow 49076.5/50000: 98% mana
0.1/5: 2% soul_shard
decimating_bolt(2), lead_by_example
1:04.813 aoe K conflagrate Fluffy_Pillow 49502.5/50000: 99% mana
0.3/5: 6% soul_shard
decimating_bolt(2)
1:06.120 aoe L incinerate Fluffy_Pillow 49656.0/50000: 99% mana
0.9/5: 18% soul_shard
backdraft, decimating_bolt(2)
1:07.339 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
decimating_bolt
1:09.079 aoe H havoc enemy2 48872.0/50000: 98% mana
1.8/5: 36% soul_shard
1:10.385 havoc N conflagrate Fluffy_Pillow 48525.0/50000: 97% mana
1.8/5: 36% soul_shard
1:11.690 havoc R chaos_bolt Fluffy_Pillow 48677.5/50000: 97% mana
3.1/5: 62% soul_shard
backdraft
1:13.518 havoc S incinerate Fluffy_Pillow 49591.5/50000: 99% mana
1.2/5: 24% soul_shard
1:15.257 havoc S incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.8/5: 36% soul_shard
1:16.996 havoc Q immolate Fluffy_Pillow 48871.0/50000: 98% mana
2.5/5: 50% soul_shard
1:18.302 havoc N conflagrate Fluffy_Pillow 48774.0/50000: 98% mana
2.6/5: 52% soul_shard
1:19.608 havoc S incinerate Fluffy_Pillow 48927.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
1:20.826 aoe E channel_demonfire Fluffy_Pillow 48536.0/50000: 97% mana
4.2/5: 84% soul_shard
1:23.660 aoe F immolate enemy3 49203.0/50000: 98% mana
4.6/5: 92% soul_shard
1:24.966 aoe I rain_of_fire Fluffy_Pillow 49106.0/50000: 98% mana
4.9/5: 98% soul_shard
1:26.272 aoe L incinerate Fluffy_Pillow 49759.0/50000: 100% mana
2.0/5: 40% soul_shard
1:28.013 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.4/5: 48% soul_shard
1:29.319 aoe I rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
1:30.625 aoe L incinerate Fluffy_Pillow 49808.5/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
1:31.845 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.5/5: 10% soul_shard
1:33.587 aoe L incinerate Fluffy_Pillow 48873.5/50000: 98% mana
0.9/5: 18% soul_shard
1:35.327 default A cataclysm Fluffy_Pillow 48743.5/50000: 97% mana
1.5/5: 30% soul_shard
1:37.067 default 9 soul_fire Fluffy_Pillow 49113.5/50000: 98% mana
1.6/5: 32% soul_shard
1:40.545 aoe H havoc enemy2 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
1:41.852 havoc N conflagrate Fluffy_Pillow 48656.0/50000: 97% mana
3.3/5: 66% soul_shard
1:43.159 havoc P decimating_bolt Fluffy_Pillow 48809.5/50000: 98% mana
4.5/5: 90% soul_shard
backdraft
1:45.333 havoc R chaos_bolt Fluffy_Pillow 47896.5/50000: 96% mana
4.9/5: 98% soul_shard
backdraft, lead_by_example
1:47.159 havoc N conflagrate Fluffy_Pillow 48809.5/50000: 98% mana
3.0/5: 60% soul_shard
decimating_bolt(3), lead_by_example
1:48.465 havoc R chaos_bolt Fluffy_Pillow 48962.5/50000: 98% mana
4.2/5: 84% soul_shard
backdraft, decimating_bolt(3), lead_by_example
1:50.294 havoc S incinerate Fluffy_Pillow 49877.0/50000: 100% mana
2.3/5: 46% soul_shard
decimating_bolt(3), lead_by_example
1:52.035 havoc Q immolate Fluffy_Pillow 49002.5/50000: 98% mana
2.9/5: 58% soul_shard
decimating_bolt(2), lead_by_example
1:53.340 aoe E channel_demonfire Fluffy_Pillow 48905.0/50000: 98% mana
3.2/5: 64% soul_shard
decimating_bolt(2)
1:56.147 aoe F immolate enemy3 49558.5/50000: 99% mana
3.6/5: 72% soul_shard
decimating_bolt(2)
1:57.454 aoe F immolate enemy2 49252.5/50000: 99% mana
3.8/5: 76% soul_shard
decimating_bolt(2)
1:58.762 aoe I rain_of_fire Fluffy_Pillow 49156.5/50000: 98% mana
3.9/5: 78% soul_shard
decimating_bolt(2)
2:00.068 aoe K conflagrate Fluffy_Pillow 49809.5/50000: 100% mana
1.0/5: 20% soul_shard
decimating_bolt(2)
2:01.375 aoe L incinerate Fluffy_Pillow 49963.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft, decimating_bolt(2)
2:02.595 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
decimating_bolt
2:03.902 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, decimating_bolt
2:05.122 aoe L incinerate Fluffy_Pillow 48766.0/50000: 98% mana
2.9/5: 58% soul_shard
2:06.862 default A cataclysm Fluffy_Pillow 48636.0/50000: 97% mana
3.5/5: 70% soul_shard
2:08.803 aoe I rain_of_fire Fluffy_Pillow 49106.5/50000: 98% mana
3.8/5: 76% soul_shard
2:10.110 aoe K conflagrate Fluffy_Pillow 49760.0/50000: 100% mana
0.9/5: 18% soul_shard
2:11.417 aoe H havoc enemy2 49913.5/50000: 100% mana
1.6/5: 32% soul_shard
backdraft
2:12.724 havoc S incinerate Fluffy_Pillow 49567.0/50000: 99% mana
1.7/5: 34% soul_shard
backdraft
2:13.943 havoc R chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
2:16.552 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
2:18.293 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
2:20.034 havoc N conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
1.9/5: 38% soul_shard
2:21.340 havoc Q immolate Fluffy_Pillow 49026.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
2:22.646 aoe E channel_demonfire Fluffy_Pillow 48929.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
2:25.612 default 9 soul_fire Fluffy_Pillow 49662.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
2:29.090 aoe F immolate enemy3 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
2:30.397 aoe I rain_of_fire Fluffy_Pillow 48906.0/50000: 98% mana
5.0/5: 100% soul_shard
2:31.702 aoe J decimating_bolt Fluffy_Pillow 49558.5/50000: 99% mana
2.1/5: 42% soul_shard
2:33.878 aoe K conflagrate Fluffy_Pillow 48002.5/50000: 96% mana
2.4/5: 48% soul_shard
lead_by_example
2:35.185 aoe I rain_of_fire Fluffy_Pillow 48156.0/50000: 96% mana
3.0/5: 60% soul_shard
backdraft, lead_by_example
2:36.491 aoe L incinerate Fluffy_Pillow 48809.0/50000: 98% mana
0.2/5: 4% soul_shard
backdraft, decimating_bolt(3), lead_by_example
2:37.711 aoe K conflagrate Fluffy_Pillow 48419.0/50000: 97% mana
0.5/5: 10% soul_shard
decimating_bolt(2), lead_by_example
2:39.016 default A cataclysm Fluffy_Pillow 48571.5/50000: 97% mana
1.1/5: 22% soul_shard
backdraft, decimating_bolt(2), lead_by_example
2:40.756 aoe L incinerate Fluffy_Pillow 48941.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft, decimating_bolt(2), lead_by_example
2:41.976 aoe H havoc enemy2 48551.5/50000: 97% mana
1.8/5: 36% soul_shard
decimating_bolt
2:43.283 havoc R chaos_bolt Fluffy_Pillow 48205.0/50000: 96% mana
2.0/5: 40% soul_shard
decimating_bolt
2:45.893 havoc S incinerate Fluffy_Pillow 49510.0/50000: 99% mana
0.4/5: 8% soul_shard
decimating_bolt
2:47.633 havoc S incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
2:49.374 havoc N conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
1.6/5: 32% soul_shard
2:50.681 havoc Q immolate Fluffy_Pillow 49026.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:51.987 havoc R chaos_bolt Fluffy_Pillow 48929.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
2:53.816 havoc N conflagrate Fluffy_Pillow 49843.5/50000: 100% mana
1.2/5: 24% soul_shard
2:55.123 aoe E channel_demonfire Fluffy_Pillow 49997.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
2:57.941 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
backdraft
2:59.163 aoe F immolate enemy3 49003.5/50000: 98% mana
3.1/5: 62% soul_shard
3:00.469 aoe I rain_of_fire Fluffy_Pillow 48906.5/50000: 98% mana
3.3/5: 66% soul_shard
3:01.776 aoe K conflagrate Fluffy_Pillow 49560.0/50000: 99% mana
0.5/5: 10% soul_shard
3:03.160 aoe L incinerate Fluffy_Pillow 49752.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
3:04.381 cds M summon_infernal Fluffy_Pillow 49003.0/50000: 98% mana
1.6/5: 32% soul_shard
3:05.687 aoe F immolate Fluffy_Pillow 48656.0/50000: 97% mana
1.9/5: 38% soul_shard
3:06.993 aoe F immolate enemy2 48559.0/50000: 97% mana
2.4/5: 48% soul_shard
3:08.301 aoe L incinerate Fluffy_Pillow 48463.0/50000: 97% mana
2.7/5: 54% soul_shard
3:10.041 aoe D rain_of_fire Fluffy_Pillow 48333.0/50000: 97% mana
3.5/5: 70% soul_shard
3:11.349 default A cataclysm Fluffy_Pillow 48987.0/50000: 98% mana
0.9/5: 18% soul_shard
3:13.088 aoe H havoc enemy2 49356.5/50000: 99% mana
1.5/5: 30% soul_shard
3:14.395 havoc N conflagrate Fluffy_Pillow 49010.0/50000: 98% mana
2.0/5: 40% soul_shard
3:15.702 havoc O soul_fire Fluffy_Pillow 49163.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
3:19.179 havoc P decimating_bolt Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:21.353 havoc R chaos_bolt Fluffy_Pillow 48001.5/50000: 96% mana
5.0/5: 100% soul_shard
backdraft, lead_by_example
3:23.180 havoc N conflagrate Fluffy_Pillow 48915.0/50000: 98% mana
3.0/5: 60% soul_shard
decimating_bolt(3), lead_by_example
3:24.487 aoe D rain_of_fire Fluffy_Pillow 49068.5/50000: 98% mana
4.5/5: 90% soul_shard
backdraft, decimating_bolt(3), lead_by_example
3:25.793 aoe E channel_demonfire Fluffy_Pillow 49721.5/50000: 99% mana
1.8/5: 36% soul_shard
backdraft, decimating_bolt(3), lead_by_example
3:28.717 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft, decimating_bolt(3), lead_by_example
3:29.936 aoe D rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.5/5: 70% soul_shard
decimating_bolt(2)
3:31.241 aoe K conflagrate Fluffy_Pillow 49654.5/50000: 99% mana
0.8/5: 16% soul_shard
decimating_bolt(2)
3:32.549 aoe F immolate enemy3 49808.5/50000: 100% mana
1.9/5: 38% soul_shard
backdraft, decimating_bolt(2)
3:33.858 aoe L incinerate Fluffy_Pillow 49253.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, decimating_bolt(2)
3:35.077 aoe F immolate enemy2 48863.0/50000: 98% mana
2.7/5: 54% soul_shard
decimating_bolt
3:36.384 aoe F immolate Fluffy_Pillow 48766.5/50000: 98% mana
2.9/5: 58% soul_shard
decimating_bolt
3:37.692 aoe I rain_of_fire Fluffy_Pillow 48670.5/50000: 97% mana
3.0/5: 60% soul_shard
decimating_bolt
3:38.999 aoe K conflagrate Fluffy_Pillow 49324.0/50000: 99% mana
0.3/5: 6% soul_shard
decimating_bolt
3:40.306 aoe L incinerate Fluffy_Pillow 49477.5/50000: 99% mana
1.0/5: 20% soul_shard
backdraft, decimating_bolt
3:41.525 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
3:43.266 default A cataclysm Fluffy_Pillow 48872.5/50000: 98% mana
1.8/5: 36% soul_shard
3:45.008 aoe H havoc enemy2 49243.5/50000: 98% mana
1.9/5: 38% soul_shard
3:46.314 havoc N conflagrate Fluffy_Pillow 48896.5/50000: 98% mana
2.1/5: 42% soul_shard
3:47.620 havoc R chaos_bolt Fluffy_Pillow 49049.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
3:49.447 havoc S incinerate Fluffy_Pillow 49963.0/50000: 100% mana
1.6/5: 32% soul_shard
3:51.187 havoc R chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
3:53.797 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
3:55.539 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.1/5: 22% soul_shard
3:56.845 havoc Q immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
3:58.150 aoe E channel_demonfire Fluffy_Pillow 49058.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
4:00.948 aoe F immolate enemy2 49707.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft
4:02.255 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft
4:03.473 aoe F immolate enemy3 48861.5/50000: 98% mana
3.1/5: 62% soul_shard
4:04.779 default 9 soul_fire Fluffy_Pillow 48764.5/50000: 98% mana
3.1/5: 62% soul_shard
4:08.258 aoe I rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
4.8/5: 96% soul_shard
4:09.566 aoe J decimating_bolt Fluffy_Pillow 49657.0/50000: 99% mana
1.9/5: 38% soul_shard
4:11.743 aoe K conflagrate Fluffy_Pillow 48003.0/50000: 96% mana
2.2/5: 44% soul_shard
lead_by_example
4:13.050 aoe L incinerate Fluffy_Pillow 48156.5/50000: 96% mana
2.9/5: 58% soul_shard
backdraft, lead_by_example
4:14.270 aoe I rain_of_fire Fluffy_Pillow 47766.5/50000: 96% mana
3.2/5: 64% soul_shard
decimating_bolt(2), lead_by_example
4:15.576 default A cataclysm Fluffy_Pillow 48419.5/50000: 97% mana
0.4/5: 8% soul_shard
decimating_bolt(2), lead_by_example
4:17.317 aoe H havoc enemy2 48790.0/50000: 98% mana
0.5/5: 10% soul_shard
decimating_bolt(2), lead_by_example
4:18.623 havoc S incinerate Fluffy_Pillow 48443.0/50000: 97% mana
0.7/5: 14% soul_shard
decimating_bolt(2), lead_by_example
4:20.362 havoc N conflagrate Fluffy_Pillow 48312.5/50000: 97% mana
1.2/5: 24% soul_shard
decimating_bolt
4:21.669 havoc R chaos_bolt Fluffy_Pillow 48466.0/50000: 97% mana
2.5/5: 50% soul_shard
backdraft, decimating_bolt
4:23.497 havoc S incinerate Fluffy_Pillow 49380.0/50000: 99% mana
0.7/5: 14% soul_shard
decimating_bolt
4:25.239 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
4:26.545 havoc R chaos_bolt Fluffy_Pillow 49156.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:28.373 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
4:29.681 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft
4:32.666 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft
4:33.972 aoe F immolate enemy2 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
4:35.278 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:36.498 aoe F immolate enemy3 48765.0/50000: 98% mana
2.9/5: 58% soul_shard
4:37.804 aoe I rain_of_fire Fluffy_Pillow 48668.0/50000: 97% mana
3.0/5: 60% soul_shard
4:39.111 aoe K conflagrate Fluffy_Pillow 49321.5/50000: 99% mana
0.4/5: 8% soul_shard
4:40.417 aoe L incinerate Fluffy_Pillow 49474.5/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
4:41.638 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.4/5: 28% soul_shard
4:43.379 aoe L incinerate Fluffy_Pillow 48873.5/50000: 98% mana
1.9/5: 38% soul_shard
4:45.119 aoe L incinerate Fluffy_Pillow 48743.5/50000: 97% mana
2.3/5: 46% soul_shard
4:46.860 aoe K conflagrate Fluffy_Pillow 48614.0/50000: 97% mana
2.7/5: 54% soul_shard
4:48.167 default A cataclysm Fluffy_Pillow 48767.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
4:49.907 aoe H havoc enemy2 49137.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
4:51.214 havoc R chaos_bolt Fluffy_Pillow 48791.0/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
4:53.040 havoc O soul_fire Fluffy_Pillow 49704.0/50000: 99% mana
1.9/5: 38% soul_shard
4:56.730 havoc P decimating_bolt Fluffy_Pillow 49002.5/50000: 98% mana
4.5/5: 90% soul_shard
4:58.913 havoc R chaos_bolt Fluffy_Pillow 48002.5/50000: 96% mana
4.8/5: 96% soul_shard
lead_by_example
5:01.523 havoc N conflagrate Fluffy_Pillow 49307.5/50000: 99% mana
3.0/5: 60% soul_shard
decimating_bolt(3), lead_by_example
5:02.828 aoe E channel_demonfire Fluffy_Pillow 49460.0/50000: 99% mana
4.2/5: 84% soul_shard
backdraft, decimating_bolt(3), lead_by_example
5:05.655 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft, decimating_bolt(3), lead_by_example
5:06.960 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft, decimating_bolt(3)
5:08.179 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
decimating_bolt(2)
5:09.485 aoe F immolate enemy3 49155.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, decimating_bolt(2)
5:10.791 aoe L incinerate Fluffy_Pillow 49058.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, decimating_bolt(2)
5:12.012 aoe F immolate Fluffy_Pillow 48668.5/50000: 97% mana
3.3/5: 66% soul_shard
decimating_bolt
5:13.318 aoe F immolate enemy2 48571.5/50000: 97% mana
3.6/5: 72% soul_shard
decimating_bolt
5:14.625 aoe I rain_of_fire Fluffy_Pillow 48475.0/50000: 97% mana
3.9/5: 78% soul_shard
decimating_bolt
5:15.932 aoe K conflagrate Fluffy_Pillow 49128.5/50000: 98% mana
1.1/5: 22% soul_shard
decimating_bolt
5:17.239 aoe L incinerate Fluffy_Pillow 49282.0/50000: 99% mana
1.7/5: 34% soul_shard
backdraft, decimating_bolt
5:18.456 aoe L incinerate Fluffy_Pillow 48890.5/50000: 98% mana
2.2/5: 44% soul_shard
5:20.196 default A cataclysm Fluffy_Pillow 48760.5/50000: 98% mana
2.5/5: 50% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Necrolord_Emeni"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=necrolord
soulbind=342156/infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Dream : 10092 dps, 5434 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10092.5 10092.5 17.4 / 0.172% 825.3 / 8.2% 21.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
405.0 402.2 Mana 0.00% 39.8 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream 10092
Cataclysm 785 7.8% 9.7 32.31sec 24263 14917 Direct 29.2 6805 13598 8094 18.9%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.73 29.20 0.00 0.00 1.6266 0.0000 236172.43 236172.43 0.00% 14917.41 14917.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.11% 23.68 14 32 6805.20 6142 7454 6804.77 6590 7028 161165 161165 0.00%
crit 18.89% 5.52 0 13 13597.69 12285 14908 13554.59 0 14837 75008 75008 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.81
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1058) 0.0% (10.5%) 12.5 24.73sec 25498 9629

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.48 0.00 186.48 0.00 2.6480 0.1604 0.00 0.00 0.00% 9629.13 9629.13

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:12.48
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1058 10.5% 0.0 0.00sec 0 0 Direct 559.4 477 954 569 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 559.44 0.00 0.00 0.0000 0.0000 318213.87 318213.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 451.80 332 595 477.01 263 1002 477.11 449 501 215479 215479 0.00%
crit 19.24% 107.64 68 155 954.01 525 2004 955.11 822 1110 102735 102735 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1302 (1789) 12.9% (17.7%) 21.5 13.69sec 25026 13385 Direct 42.7 (85.0) 0 9158 9158 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.46 42.70 0.00 0.00 1.8697 0.0000 391072.79 391072.79 0.00% 13385.25 13385.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.70 26 56 9158.42 5867 12567 9159.23 8942 9347 391073 391073 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.57
  • if_expr:cast_time<havoc_remains
    Internal Combustion 487 4.8% 42.3 13.65sec 3455 0 Direct 42.3 2895 5802 3455 19.3%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.28 42.28 0.00 0.00 0.0000 0.0000 146090.74 146090.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 34.12 21 50 2894.55 1 4387 2896.77 2646 3185 98759 98759 0.00%
crit 19.30% 8.16 1 18 5801.55 9 8768 5789.13 4115 7181 47332 47332 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 836 8.3% 38.1 7.73sec 6595 5467 Direct 57.4 3671 7364 4384 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.14 57.40 0.00 0.00 1.2063 0.0000 251549.59 251549.59 0.00% 5467.40 5467.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 46.33 33 61 3670.96 2047 5177 3670.75 3338 3969 170037 170037 0.00%
crit 19.29% 11.07 2 22 7364.29 4096 10353 7368.99 5722 9122 81513 81513 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:18.88
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.24
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1672 16.6% 26.8 10.78sec 18769 15227 Direct 34.7 1553 3094 1857 19.7%
Periodic 358.2 1027 2054 1224 19.2% 95.5%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.80 34.72 358.23 358.23 1.2326 2.4079 503032.67 503032.67 0.00% 561.67 15227.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.31% 27.88 17 39 1553.39 821 2071 1554.05 1451 1657 43307 43307 0.00%
crit 19.69% 6.84 0 14 3093.85 1639 4141 3087.07 0 3890 21154 21154 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.78% 289.37 222 357 1026.83 1 1294 1026.85 1003 1044 297135 297135 0.00%
crit 19.22% 68.85 38 105 2054.23 1 2588 2054.35 1957 2153 141436 141436 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:16.71
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:10.19
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 698 6.9% 48.9 5.84sec 4302 3025 Direct 62.8 (62.8) 2811 5618 3349 19.1% (19.1%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 48.89 62.80 0.00 0.00 1.4221 0.0000 210299.76 210299.76 0.00% 3025.07 3025.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 50.80 31 72 2811.18 1313 3517 2813.13 2646 3017 142816 142816 0.00%
crit 19.12% 12.01 3 25 5618.42 2628 7034 5620.48 4342 6656 67483 67483 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:34.79
    havoc
    [R]:14.33
  • if_expr:cast_time<havoc_remains
Rain of Fire 987 9.8% 18.7 15.27sec 15879 13084 Periodic 443.7 560 1121 668 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.67 0.00 0.00 443.66 1.2137 0.0000 296484.77 296484.77 0.00% 13084.06 13084.06
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.77% 358.33 229 526 560.49 507 615 560.47 551 568 200839 200839 0.00%
crit 19.23% 85.33 43 126 1120.90 1013 1230 1120.82 1102 1146 95646 95646 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.42
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:13.25
Soul Fire 520 5.2% 5.6 49.39sec 27914 8193 Direct 7.7 16893 34020 20230 19.4%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.60 7.73 0.00 0.00 3.4071 0.0000 156397.31 156397.31 0.00% 8193.06 8193.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 6.23 2 11 16892.60 8606 21738 16934.34 13605 19697 105298 105298 0.00%
crit 19.41% 1.50 0 5 34020.48 17336 43419 27531.62 0 43154 51099 51099 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.52
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.19
  • if_expr:cast_time<havoc_remains
Soul Rot 374 3.7% 5.3 62.08sec 21149 16919 Periodic 113.2 832 1665 993 19.4% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.32 0.00 113.25 113.25 1.2501 1.1121 112526.70 112526.70 0.00% 848.66 16918.76
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.59% 91.27 63 114 831.80 29 1432 832.13 772 895 75903 75903 0.00%
crit 19.41% 21.98 9 36 1664.80 58 2865 1666.01 1155 2115 36624 36624 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.33
Summon Infernal 81 0.8% 2.0 180.87sec 12097 11098 Direct 6.0 3405 6806 4034 18.4%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.0904 0.0000 24193.29 24193.29 0.00% 11097.84 11097.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.55% 4.89 2 6 3404.68 3348 3437 3404.40 3348 3437 16659 16659 0.00%
crit 18.45% 1.11 0 4 6806.06 6696 6875 4864.01 0 6875 7534 7534 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3737 / 755
Immolation 3456 6.8% 41.0 5.23sec 5057 0 Direct 123.0 1414 2827 1686 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 123.00 0.00 0.00 0.0000 0.0000 207337.99 207337.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 99.33 85 113 1413.62 1395 1432 1413.63 1411 1417 140418 140418 0.00%
crit 19.24% 23.67 10 38 2827.42 2790 2865 2827.51 2807 2849 66920 66920 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 282 0.6% 43.0 5.01sec 393 289 Direct 43.0 330 660 394 19.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.00 43.00 0.00 0.00 1.3628 0.0000 16919.19 24167.37 29.99% 288.71 288.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 34.72 25 41 329.97 326 334 329.97 329 331 11456 16363 29.99%
crit 19.26% 8.28 2 18 659.62 651 668 659.59 651 668 5463 7804 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 537 / 537
Firebolt 537 5.3% 96.4 3.12sec 1674 1187 Direct 95.7 1413 2826 1687 19.4%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.42 95.66 0.00 0.00 1.4101 0.0000 161378.62 161378.62 0.00% 1186.97 1186.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 77.12 53 98 1413.36 1395 1432 1413.31 1410 1416 109002 109002 0.00%
crit 19.37% 18.53 7 35 2826.17 2790 2865 2826.17 2790 2851 52377 52377 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:96.80
Simple Action Stats Execute Interval
NightFae_Dream
Havoc 9.7 32.06sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.68 0.00 0.00 0.00 1.1766 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.69
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 38.1 0.0 7.7sec 7.7sec 3.8sec 47.68% 0.00% 0.0 (0.0) 1.5

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 26.6s
  • trigger_min/max:2.1s / 26.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:47.68%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Field of Blossoms 5.3 0.0 62.1sec 62.1sec 14.7sec 25.89% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_field_of_blossoms
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 69.3s
  • trigger_min/max:61.3s / 69.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • field_of_blossoms_1:25.89%

Spelldata

  • id:342774
  • name:Field of Blossoms
  • tooltip:Haste increased by $w%.
  • description:{$@spelldesc319191=$?a137005[Death's Due]?a212611[The Hunt]?a137009[Convoke the Spirits]?a137014[Wild Spirits]?a137018[Shifting Power]?a137022[Faeline Stomp]?a137026[Blessing of Seasons]?a137030[Fae Guardians]?a137034[Sepsis]?a137038[Fae Transfusion]?a137042[Soul Rot]?a137047[Ancient Aftershock][Activating your Night Fae class ability] puts flowers at your feet for ${{$342761d=15 seconds}*$<mod>}.1 sec that increase your Haste by {$342774s1=12}% while you stand with them.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Social Butterfly 30.6 0.0 10.0sec 10.0sec 5.0sec 50.42% 0.00% 0.0 (0.0) 30.1

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_social_butterfly
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 10.0s
  • trigger_min/max:10.0s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 5.0s

Stack Uptimes

  • social_butterfly_1:50.42%

Spelldata

  • id:320130
  • name:Social Butterfly
  • tooltip:Versatility increased by $w1%.
  • description:{$@spelldesc319210=When at least {$s3=2} allies are within {$s4=8} yd, your Versatility increases by {$320130s1=3}% for {$320130d=5 seconds}. When this expires, {$s3=2} nearby allies gain ${{$320212s1=1}/{$320130s1=3}*100}% of this effect for {$320212d=5 seconds} before passing it back to you.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Soul Rot 5.3 0.0 62.1sec 62.1sec 7.9sec 13.99% 0.00% 0.0 (0.0) 5.2

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 69.3s
  • trigger_min/max:61.3s / 69.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 8.0s

Stack Uptimes

  • soul_rot_1:13.99%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.9sec 180.9sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 187.9s
  • trigger_min/max:180.0s / 187.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.9sec 180.9sec 30.0sec 100.00% 0.00% 41.0 (41.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 187.9s
  • trigger_min/max:180.0s / 187.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.99% 7.53% 14.15% 0.7s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream
soul_fire Soul Shard 6.61 7.22 7.35% 1.09 0.57 7.33%
immolate Soul Shard 358.20 34.57 35.20% 0.10 1.25 3.48%
incinerate Soul Shard 48.89 12.62 12.85% 0.26 0.01 0.09%
conflagrate Soul Shard 38.12 28.67 29.19% 0.75 0.00 0.00%
mana_regen Mana 692.57 121075.25 100.00% 174.82 29112.35 19.38%
immolate_crits Soul Shard 34.17 3.29 3.35% 0.10 0.13 3.73%
incinerate_crits Soul Shard 12.03 1.20 1.22% 0.10 0.00 0.08%
infernal Soul Shard 120.00 10.64 10.83% 0.09 1.36 11.37%
pet - imp
energy_regen Energy 373.70 3684.23 100.00% 9.86 22.74 0.61%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 402.22 404.99 29141.6 49165.7 47460.5 50000.0
Soul Shard 4.0 0.33 0.33 3.3 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Dream
cataclysm Mana 9.7 4870.1 500.0 500.3 48.5
channel_demonfire Mana 12.5 9360.4 750.0 750.0 34.0
chaos_bolt Soul Shard 21.4 42.9 2.0 2.0 12531.6
conflagrate Mana 38.1 19062.2 500.0 499.8 13.2
havoc Mana 9.7 9685.8 1000.0 1000.7 0.0
immolate Mana 26.8 20099.5 750.0 750.0 25.0
incinerate Mana 48.9 48889.6 1000.0 1000.1 4.3
rain_of_fire Soul Shard 18.7 56.0 3.0 3.0 5292.9
soul_fire Mana 6.6 6612.8 1000.0 1180.2 23.7
soul_rot Mana 5.3 1328.1 250.0 249.6 84.7
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 96.4 3856.4 40.0 40.0 41.8

Statistics & Data Analysis

Fight Length
NightFae_Dream Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
NightFae_Dream Damage Per Second
Count 627
Mean 10092.48
Minimum 9540.81
Maximum 10852.86
Spread ( max - min ) 1312.05
Range [ ( max - min ) / 2 * 100% ] 6.50%
Standard Deviation 221.8844
5th Percentile 9747.22
95th Percentile 10441.77
( 95th Percentile - 5th Percentile ) 694.54
Mean Distribution
Standard Deviation 8.8612
95.00% Confidence Interval ( 10075.12 - 10109.85 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1857
0.1 Scale Factor Error with Delta=300 421
0.05 Scale Factor Error with Delta=300 1682
0.01 Scale Factor Error with Delta=300 42028
Priority Target DPS
NightFae_Dream Priority Target Damage Per Second
Count 627
Mean 5434.49
Minimum 5078.81
Maximum 6018.45
Spread ( max - min ) 939.64
Range [ ( max - min ) / 2 * 100% ] 8.65%
Standard Deviation 130.7394
5th Percentile 5226.56
95th Percentile 5649.44
( 95th Percentile - 5th Percentile ) 422.88
Mean Distribution
Standard Deviation 5.2212
95.00% Confidence Interval ( 5424.26 - 5444.72 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2224
0.1 Scale Factor Error with Delta=300 146
0.05 Scale Factor Error with Delta=300 584
0.01 Scale Factor Error with Delta=300 14592
DPS(e)
NightFae_Dream Damage Per Second (Effective)
Count 627
Mean 10092.48
Minimum 9540.81
Maximum 10852.86
Spread ( max - min ) 1312.05
Range [ ( max - min ) / 2 * 100% ] 6.50%
Damage
NightFae_Dream Damage
Count 627
Mean 2646033.93
Minimum 2121624.03
Maximum 3185206.65
Spread ( max - min ) 1063582.61
Range [ ( max - min ) / 2 * 100% ] 20.10%
DTPS
NightFae_Dream Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_DreamTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.52 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.81 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.42 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.33 soul_rot
F 12.48 channel_demonfire,if=dot.immolate.remains>cast_time
G 16.71 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.69 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 13.25 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 18.88 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 34.79 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.24 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.19 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 10.19 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.57 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 14.33 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNRPDFGDGKLLKDLLALJFINQRNOPJLGKJFLKLEALKIQQRNPQFKLGLGGJKL9AINQQRNPFLJLGKLLLEJKLAIRNQRQPN9FJGKGLLJKLAIRQRNQPFKLLGLMDEKLL9AFIQNQNPQNDLLGGFGJKLKAIQRNQRP9FJEGKLKJLLKAIQRRNQRPFGKJGLLKLLL9AFIQNQNPQNEJLGLFG

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
social_butterfly
0:01.740 aoe E soul_rot Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, social_butterfly
0:02.748 aoe F channel_demonfire Fluffy_Pillow 49624.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot, field_of_blossoms, social_butterfly
0:04.762 cds M summon_infernal Fluffy_Pillow 49881.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot, field_of_blossoms, social_butterfly
0:05.660 aoe I havoc enemy2 49330.0/50000: 99% mana
4.7/5: 94% soul_shard
bloodlust, soul_rot, field_of_blossoms
0:06.559 havoc Q chaos_bolt Fluffy_Pillow 48779.5/50000: 98% mana
4.9/5: 98% soul_shard
bloodlust, soul_rot, field_of_blossoms
0:08.354 havoc N conflagrate Fluffy_Pillow 49677.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot, field_of_blossoms
0:09.252 havoc Q chaos_bolt Fluffy_Pillow 49626.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot, field_of_blossoms
0:10.507 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, soul_rot, field_of_blossoms, social_butterfly
0:11.407 havoc P immolate Fluffy_Pillow 49950.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, field_of_blossoms, social_butterfly
0:12.306 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, field_of_blossoms, social_butterfly
0:13.563 havoc N conflagrate Fluffy_Pillow 49881.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, field_of_blossoms, social_butterfly
0:14.461 havoc Q chaos_bolt Fluffy_Pillow 49830.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, field_of_blossoms, social_butterfly
0:15.717 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, field_of_blossoms
0:16.616 havoc R incinerate Fluffy_Pillow 49949.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, field_of_blossoms
0:17.455 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
4.9/5: 98% soul_shard
bloodlust, field_of_blossoms
0:18.353 aoe D rain_of_fire Fluffy_Pillow 48701.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:19.359 aoe F channel_demonfire Fluffy_Pillow 49204.5/50000: 98% mana
2.3/5: 46% soul_shard
bloodlust
0:21.602 aoe G immolate enemy2 49576.0/50000: 99% mana
2.9/5: 58% soul_shard
bloodlust, social_butterfly
0:22.609 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.2/5: 64% soul_shard
bloodlust, social_butterfly
0:23.614 aoe G immolate enemy3 49755.0/50000: 100% mana
0.4/5: 8% soul_shard
bloodlust, social_butterfly
0:24.620 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
0.8/5: 16% soul_shard
bloodlust, social_butterfly
0:25.625 aoe L incinerate Fluffy_Pillow 49254.5/50000: 99% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:26.565 aoe L incinerate Fluffy_Pillow 48724.5/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust
0:27.907 aoe K conflagrate Fluffy_Pillow 48395.5/50000: 97% mana
2.7/5: 54% soul_shard
bloodlust
0:28.914 aoe D rain_of_fire Fluffy_Pillow 48399.0/50000: 97% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:29.921 aoe L incinerate Fluffy_Pillow 48902.5/50000: 98% mana
1.0/5: 20% soul_shard
bloodlust, backdraft
0:30.861 aoe L incinerate Fluffy_Pillow 48372.5/50000: 97% mana
1.7/5: 34% soul_shard
bloodlust, social_butterfly
0:32.202 default A cataclysm Fluffy_Pillow 48043.0/50000: 96% mana
2.2/5: 44% soul_shard
bloodlust, social_butterfly
0:33.543 aoe L incinerate Fluffy_Pillow 48213.5/50000: 96% mana
2.7/5: 54% soul_shard
bloodlust, social_butterfly
0:34.884 aoe J rain_of_fire Fluffy_Pillow 47884.0/50000: 96% mana
3.5/5: 70% soul_shard
bloodlust, social_butterfly
0:35.890 aoe F channel_demonfire Fluffy_Pillow 48387.0/50000: 97% mana
0.5/5: 10% soul_shard
bloodlust
0:38.336 aoe I havoc enemy2 48860.0/50000: 98% mana
0.9/5: 18% soul_shard
bloodlust
0:39.342 havoc N conflagrate Fluffy_Pillow 48363.0/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust
0:40.349 havoc Q chaos_bolt Fluffy_Pillow 48366.5/50000: 97% mana
2.2/5: 44% soul_shard
bloodlust, backdraft, social_butterfly
0:41.755 havoc R incinerate Fluffy_Pillow 49069.5/50000: 98% mana
0.4/5: 8% soul_shard
social_butterfly
0:43.495 havoc N conflagrate Fluffy_Pillow 48939.5/50000: 98% mana
1.2/5: 24% soul_shard
social_butterfly
0:44.802 havoc O soul_fire Fluffy_Pillow 49093.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, social_butterfly
0:48.477 havoc P immolate Fluffy_Pillow 49002.0/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
0:49.783 aoe J rain_of_fire Fluffy_Pillow 48905.0/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
0:51.092 aoe L incinerate Fluffy_Pillow 49559.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, social_butterfly
0:52.312 aoe G immolate enemy3 49002.5/50000: 98% mana
2.4/5: 48% soul_shard
social_butterfly
0:53.618 aoe K conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
2.7/5: 54% soul_shard
social_butterfly
0:54.925 aoe J rain_of_fire Fluffy_Pillow 49059.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, social_butterfly
0:56.232 aoe F channel_demonfire Fluffy_Pillow 49712.5/50000: 99% mana
0.5/5: 10% soul_shard
backdraft
0:59.156 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
1:00.375 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
social_butterfly
1:01.682 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.8/5: 36% soul_shard
backdraft, social_butterfly
1:02.902 aoe E soul_rot Fluffy_Pillow 48765.5/50000: 98% mana
2.1/5: 42% soul_shard
social_butterfly
1:04.209 default A cataclysm Fluffy_Pillow 49169.0/50000: 98% mana
2.3/5: 46% soul_shard
soul_rot, field_of_blossoms, social_butterfly
1:05.765 aoe L incinerate Fluffy_Pillow 49447.0/50000: 99% mana
2.5/5: 50% soul_shard
soul_rot, field_of_blossoms
1:07.318 aoe K conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
2.9/5: 58% soul_shard
soul_rot, field_of_blossoms
1:08.485 aoe I havoc enemy2 49085.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft, soul_rot, field_of_blossoms
1:09.652 havoc Q chaos_bolt Fluffy_Pillow 48668.5/50000: 97% mana
3.9/5: 78% soul_shard
backdraft, soul_rot, field_of_blossoms
1:11.284 havoc Q chaos_bolt Fluffy_Pillow 49484.5/50000: 99% mana
2.3/5: 46% soul_shard
soul_rot, field_of_blossoms, social_butterfly
1:13.613 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
field_of_blossoms, social_butterfly
1:15.169 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.1/5: 22% soul_shard
field_of_blossoms
1:16.337 havoc P immolate Fluffy_Pillow 49087.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, field_of_blossoms
1:17.506 havoc Q chaos_bolt Fluffy_Pillow 48921.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, field_of_blossoms
1:19.139 aoe F channel_demonfire Fluffy_Pillow 49738.0/50000: 99% mana
0.6/5: 12% soul_shard
field_of_blossoms
1:21.790 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
social_butterfly
1:23.095 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft, social_butterfly
1:24.315 aoe G immolate enemy3 49002.5/50000: 98% mana
1.9/5: 38% soul_shard
social_butterfly
1:25.623 aoe L incinerate Fluffy_Pillow 48906.5/50000: 98% mana
2.4/5: 48% soul_shard
1:27.363 aoe G immolate Fluffy_Pillow 48776.5/50000: 98% mana
2.7/5: 54% soul_shard
1:28.667 aoe G immolate enemy2 48678.5/50000: 97% mana
2.9/5: 58% soul_shard
1:29.974 aoe J rain_of_fire Fluffy_Pillow 48582.0/50000: 97% mana
3.0/5: 60% soul_shard
1:31.280 aoe K conflagrate Fluffy_Pillow 49235.0/50000: 98% mana
0.2/5: 4% soul_shard
social_butterfly
1:32.587 aoe L incinerate Fluffy_Pillow 49388.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft, social_butterfly
1:33.805 default 9 soul_fire Fluffy_Pillow 48997.5/50000: 98% mana
1.2/5: 24% soul_shard
social_butterfly
1:37.284 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
2.5/5: 50% soul_shard
1:39.025 aoe I havoc enemy2 49373.5/50000: 99% mana
2.8/5: 56% soul_shard
1:40.330 havoc N conflagrate Fluffy_Pillow 49026.0/50000: 98% mana
2.9/5: 58% soul_shard
social_butterfly
1:41.636 havoc Q chaos_bolt Fluffy_Pillow 49179.0/50000: 98% mana
4.1/5: 82% soul_shard
backdraft, social_butterfly
1:43.464 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
social_butterfly
1:46.075 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
1:47.816 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
1:49.122 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:50.427 aoe F channel_demonfire Fluffy_Pillow 49058.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, social_butterfly
1:53.294 aoe L incinerate Fluffy_Pillow 49741.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft, social_butterfly
1:54.513 aoe J rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.4/5: 68% soul_shard
social_butterfly
1:55.821 aoe L incinerate Fluffy_Pillow 49656.0/50000: 99% mana
0.4/5: 8% soul_shard
1:57.561 aoe G immolate enemy3 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
1:58.868 aoe K conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
1.1/5: 22% soul_shard
2:00.174 aoe L incinerate Fluffy_Pillow 49058.5/50000: 98% mana
1.8/5: 36% soul_shard
backdraft, social_butterfly
2:01.393 aoe L incinerate Fluffy_Pillow 48668.0/50000: 97% mana
2.1/5: 42% soul_shard
social_butterfly
2:03.134 aoe L incinerate Fluffy_Pillow 48538.5/50000: 97% mana
2.5/5: 50% soul_shard
social_butterfly
2:04.878 aoe E soul_rot Fluffy_Pillow 48410.5/50000: 97% mana
3.1/5: 62% soul_shard
social_butterfly
2:06.184 aoe J rain_of_fire Fluffy_Pillow 48813.5/50000: 98% mana
3.1/5: 62% soul_shard
soul_rot, field_of_blossoms
2:07.353 aoe K conflagrate Fluffy_Pillow 49398.0/50000: 99% mana
0.4/5: 8% soul_shard
soul_rot, field_of_blossoms
2:08.522 aoe L incinerate Fluffy_Pillow 49482.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft, soul_rot, field_of_blossoms
2:09.611 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
soul_rot, field_of_blossoms
2:11.165 aoe I havoc enemy2 49279.0/50000: 99% mana
1.7/5: 34% soul_shard
soul_rot, field_of_blossoms, social_butterfly
2:12.331 havoc R incinerate Fluffy_Pillow 48862.0/50000: 98% mana
1.8/5: 36% soul_shard
soul_rot, field_of_blossoms, social_butterfly
2:13.887 havoc N conflagrate Fluffy_Pillow 48640.0/50000: 97% mana
2.4/5: 48% soul_shard
soul_rot, field_of_blossoms, social_butterfly
2:15.054 havoc Q chaos_bolt Fluffy_Pillow 48723.5/50000: 97% mana
3.5/5: 70% soul_shard
backdraft, field_of_blossoms
2:16.687 havoc R incinerate Fluffy_Pillow 49540.0/50000: 99% mana
1.9/5: 38% soul_shard
field_of_blossoms
2:18.243 havoc Q chaos_bolt Fluffy_Pillow 49003.0/50000: 98% mana
2.5/5: 50% soul_shard
field_of_blossoms
2:20.574 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
field_of_blossoms, social_butterfly
2:21.742 havoc N conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.0/5: 20% soul_shard
social_butterfly
2:23.049 default 9 soul_fire Fluffy_Pillow 49406.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, social_butterfly
2:26.526 aoe F channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
2:29.230 aoe J rain_of_fire Fluffy_Pillow 49604.0/50000: 99% mana
3.9/5: 78% soul_shard
backdraft
2:30.536 aoe G immolate enemy3 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft, social_butterfly
2:31.843 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.2/5: 24% soul_shard
social_butterfly
2:33.149 aoe G immolate enemy2 49405.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft, social_butterfly
2:34.455 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, social_butterfly
2:35.675 aoe L incinerate Fluffy_Pillow 48862.0/50000: 98% mana
2.4/5: 48% soul_shard
2:37.416 aoe J rain_of_fire Fluffy_Pillow 48732.5/50000: 97% mana
3.0/5: 60% soul_shard
2:38.723 aoe K conflagrate Fluffy_Pillow 49386.0/50000: 99% mana
0.2/5: 4% soul_shard
2:40.029 aoe L incinerate Fluffy_Pillow 49539.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft, social_butterfly
2:41.248 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
social_butterfly
2:42.989 aoe I havoc enemy2 49372.5/50000: 99% mana
1.3/5: 26% soul_shard
social_butterfly
2:44.297 havoc R incinerate Fluffy_Pillow 49026.5/50000: 98% mana
1.6/5: 32% soul_shard
social_butterfly
2:46.037 havoc Q chaos_bolt Fluffy_Pillow 48896.5/50000: 98% mana
2.0/5: 40% soul_shard
2:48.648 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
2:50.387 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.2/5: 24% soul_shard
social_butterfly
2:51.692 havoc Q chaos_bolt Fluffy_Pillow 49154.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, social_butterfly
2:53.520 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
social_butterfly
2:54.828 aoe F channel_demonfire Fluffy_Pillow 49253.0/50000: 99% mana
0.8/5: 16% soul_shard
social_butterfly
2:57.675 aoe K conflagrate Fluffy_Pillow 49926.5/50000: 100% mana
1.2/5: 24% soul_shard
2:58.982 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
3:00.202 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
social_butterfly
3:01.943 aoe G immolate enemy3 48873.0/50000: 98% mana
2.7/5: 54% soul_shard
social_butterfly
3:03.251 aoe L incinerate Fluffy_Pillow 48777.0/50000: 98% mana
2.8/5: 56% soul_shard
social_butterfly
3:04.993 cds M summon_infernal Fluffy_Pillow 48648.0/50000: 97% mana
3.3/5: 66% soul_shard
social_butterfly
3:06.298 aoe D rain_of_fire Fluffy_Pillow 48300.5/50000: 97% mana
3.5/5: 70% soul_shard
3:07.603 aoe E soul_rot Fluffy_Pillow 48953.0/50000: 98% mana
1.1/5: 22% soul_shard
3:08.909 aoe K conflagrate Fluffy_Pillow 49356.0/50000: 99% mana
1.3/5: 26% soul_shard
soul_rot, field_of_blossoms
3:10.076 aoe L incinerate Fluffy_Pillow 49439.5/50000: 99% mana
2.3/5: 46% soul_shard
backdraft, soul_rot, field_of_blossoms, social_butterfly
3:11.166 aoe L incinerate Fluffy_Pillow 48984.5/50000: 98% mana
2.8/5: 56% soul_shard
soul_rot, field_of_blossoms, social_butterfly
3:12.720 default 9 soul_fire Fluffy_Pillow 48761.5/50000: 98% mana
3.6/5: 72% soul_shard
soul_rot, field_of_blossoms, social_butterfly
3:15.827 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
5.0/5: 100% soul_shard
soul_rot, field_of_blossoms
3:17.382 aoe F channel_demonfire Fluffy_Pillow 49280.5/50000: 99% mana
5.0/5: 100% soul_shard
field_of_blossoms
3:19.857 aoe I havoc enemy2 49768.0/50000: 100% mana
5.0/5: 100% soul_shard
field_of_blossoms
3:21.026 havoc Q chaos_bolt Fluffy_Pillow 49352.5/50000: 99% mana
5.0/5: 100% soul_shard
field_of_blossoms, social_butterfly
3:23.356 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
field_of_blossoms, social_butterfly
3:24.524 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft, social_butterfly
3:26.353 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:27.660 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:28.967 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
3:30.794 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
social_butterfly
3:32.100 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft, social_butterfly
3:33.407 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
backdraft, social_butterfly
3:34.626 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
social_butterfly
3:36.366 aoe G immolate enemy3 48872.0/50000: 98% mana
2.9/5: 58% soul_shard
3:37.671 aoe G immolate enemy2 48774.5/50000: 98% mana
3.3/5: 66% soul_shard
3:38.980 aoe F channel_demonfire Fluffy_Pillow 48679.0/50000: 97% mana
3.3/5: 66% soul_shard
3:41.858 aoe G immolate Fluffy_Pillow 49368.0/50000: 99% mana
3.6/5: 72% soul_shard
social_butterfly
3:43.164 aoe J rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.9/5: 78% soul_shard
social_butterfly
3:44.471 aoe K conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
0.9/5: 18% soul_shard
social_butterfly
3:45.777 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
backdraft
3:46.997 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
3:48.304 default A cataclysm Fluffy_Pillow 49156.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
3:50.044 aoe I havoc enemy2 49502.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft, social_butterfly
3:51.351 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, social_butterfly
3:53.177 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
social_butterfly
3:54.917 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.0/5: 40% soul_shard
social_butterfly
3:56.222 havoc Q chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
3:58.049 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
3:59.790 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
4:01.097 default 9 soul_fire Fluffy_Pillow 48906.0/50000: 98% mana
2.4/5: 48% soul_shard
social_butterfly
4:04.574 aoe F channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
3.8/5: 76% soul_shard
social_butterfly
4:07.355 aoe J rain_of_fire Fluffy_Pillow 49642.5/50000: 99% mana
4.1/5: 82% soul_shard
4:08.660 aoe E soul_rot Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
4:10.210 aoe G immolate enemy3 49751.5/50000: 100% mana
1.5/5: 30% soul_shard
soul_rot, field_of_blossoms, social_butterfly
4:11.379 aoe K conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.9/5: 38% soul_shard
soul_rot, field_of_blossoms, social_butterfly
4:12.547 aoe L incinerate Fluffy_Pillow 49337.0/50000: 99% mana
2.4/5: 48% soul_shard
backdraft, soul_rot, field_of_blossoms, social_butterfly
4:13.637 aoe K conflagrate Fluffy_Pillow 48882.0/50000: 98% mana
2.9/5: 58% soul_shard
soul_rot, field_of_blossoms, social_butterfly
4:14.805 aoe J rain_of_fire Fluffy_Pillow 48966.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, soul_rot, field_of_blossoms, social_butterfly
4:15.971 aoe L incinerate Fluffy_Pillow 49549.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft, soul_rot, field_of_blossoms
4:17.060 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
soul_rot, field_of_blossoms
4:18.616 aoe K conflagrate Fluffy_Pillow 48780.0/50000: 98% mana
1.5/5: 30% soul_shard
field_of_blossoms
4:19.948 default A cataclysm Fluffy_Pillow 48946.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, field_of_blossoms
4:21.595 aoe I havoc enemy2 49269.5/50000: 99% mana
2.4/5: 48% soul_shard
backdraft, field_of_blossoms, social_butterfly
4:22.762 havoc Q chaos_bolt Fluffy_Pillow 48853.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, field_of_blossoms, social_butterfly
4:24.395 havoc R incinerate Fluffy_Pillow 49669.5/50000: 99% mana
0.7/5: 14% soul_shard
field_of_blossoms, social_butterfly
4:25.948 havoc R incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
4:27.688 havoc N conflagrate Fluffy_Pillow 48871.5/50000: 98% mana
2.0/5: 40% soul_shard
4:28.995 havoc Q chaos_bolt Fluffy_Pillow 49025.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
4:30.822 havoc R incinerate Fluffy_Pillow 49938.5/50000: 100% mana
1.5/5: 30% soul_shard
social_butterfly
4:32.563 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
social_butterfly
4:33.870 aoe F channel_demonfire Fluffy_Pillow 48906.0/50000: 98% mana
2.2/5: 44% soul_shard
social_butterfly
4:36.753 aoe G immolate enemy2 49597.5/50000: 99% mana
2.4/5: 48% soul_shard
4:38.059 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
4:39.363 aoe J rain_of_fire Fluffy_Pillow 49404.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
4:40.669 aoe G immolate enemy3 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft, social_butterfly
4:41.974 aoe L incinerate Fluffy_Pillow 49251.5/50000: 99% mana
0.4/5: 8% soul_shard
backdraft, social_butterfly
4:43.193 aoe L incinerate Fluffy_Pillow 48861.0/50000: 98% mana
0.8/5: 16% soul_shard
social_butterfly
4:44.933 aoe K conflagrate Fluffy_Pillow 48731.0/50000: 97% mana
1.1/5: 22% soul_shard
social_butterfly
4:46.240 aoe L incinerate Fluffy_Pillow 48884.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
4:47.461 aoe L incinerate Fluffy_Pillow 48495.0/50000: 97% mana
2.1/5: 42% soul_shard
4:49.202 aoe L incinerate Fluffy_Pillow 48365.5/50000: 97% mana
2.6/5: 52% soul_shard
4:50.942 default 9 soul_fire Fluffy_Pillow 48235.5/50000: 96% mana
3.0/5: 60% soul_shard
social_butterfly
4:54.421 default A cataclysm Fluffy_Pillow 48975.0/50000: 98% mana
4.6/5: 92% soul_shard
social_butterfly
4:56.161 aoe F channel_demonfire Fluffy_Pillow 49345.0/50000: 99% mana
4.8/5: 96% soul_shard
4:58.929 aoe I havoc enemy2 49979.0/50000: 100% mana
5.0/5: 100% soul_shard
5:00.235 havoc Q chaos_bolt Fluffy_Pillow 49632.0/50000: 99% mana
5.0/5: 100% soul_shard
social_butterfly
5:02.846 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
social_butterfly
5:04.153 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft, social_butterfly
5:05.979 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
5:07.286 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
5:08.594 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
5:10.422 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
social_butterfly
5:11.728 aoe E soul_rot Fluffy_Pillow 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft, social_butterfly
5:13.035 aoe J rain_of_fire Fluffy_Pillow 49752.5/50000: 100% mana
3.2/5: 64% soul_shard
backdraft, soul_rot, field_of_blossoms, social_butterfly
5:14.202 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft, soul_rot, field_of_blossoms, social_butterfly
5:15.291 aoe G immolate enemy3 49002.0/50000: 98% mana
0.7/5: 14% soul_shard
soul_rot, field_of_blossoms
5:16.458 aoe L incinerate Fluffy_Pillow 48835.5/50000: 98% mana
0.8/5: 16% soul_shard
soul_rot, field_of_blossoms
5:18.013 aoe F channel_demonfire Fluffy_Pillow 48613.0/50000: 97% mana
1.3/5: 26% soul_shard
soul_rot, field_of_blossoms
5:20.515 aoe G immolate Fluffy_Pillow 49114.0/50000: 98% mana
1.8/5: 36% soul_shard
soul_rot, field_of_blossoms, social_butterfly

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Dream"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=319191/319210/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Koraylon : 9978 dps, 5387 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9978.2 9978.2 17.7 / 0.177% 819.1 / 8.2% 22.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.2 385.6 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Koraylon 9978
Cataclysm 799 8.0% 9.7 32.40sec 24731 14554 Direct 29.1 6899 13791 8240 19.5%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.71 29.14 0.00 0.00 1.6993 0.0000 240208.75 240208.75 0.00% 14553.70 14553.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.50% 23.46 13 32 6899.36 6141 7987 6899.25 6676 7121 161834 161834 0.00%
crit 19.50% 5.68 0 14 13790.99 12283 15969 13785.11 0 15925 78375 78375 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.78
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1057) 0.0% (10.6%) 12.1 26.00sec 26301 9766

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.08 0.00 180.45 0.00 2.6931 0.1635 0.00 0.00 0.00% 9766.01 9766.01

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:12.07
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1057 10.6% 0.0 0.00sec 0 0 Direct 541.4 492 985 587 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 541.36 0.00 0.00 0.0000 0.0000 317707.99 317707.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 436.92 304 582 491.82 263 1074 492.19 460 521 214877 214877 0.00%
crit 19.29% 104.44 61 149 984.77 525 2148 985.52 831 1166 102831 102831 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1351 (1833) 13.5% (18.4%) 21.9 13.24sec 25160 12835 Direct 43.6 (86.8) 0 9321 9321 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.89 43.56 0.00 0.00 1.9602 0.0000 406044.15 406044.15 0.00% 12835.43 12835.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.56 30 60 9321.49 5861 13464 9320.17 9078 9537 406044 406044 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.00
  • if_expr:cast_time<havoc_remains
    Internal Combustion 482 4.8% 43.2 13.26sec 3350 0 Direct 43.2 2813 5612 3350 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.20 43.20 0.00 0.00 0.0000 0.0000 144736.82 144736.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 34.90 22 51 2813.29 1 4495 2814.73 2595 3103 98179 98179 0.00%
crit 19.21% 8.30 1 17 5612.39 265 8986 5608.06 3856 8407 46557 46557 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 833 8.4% 37.1 7.94sec 6758 5402 Direct 56.8 3699 7409 4412 19.2%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.06 56.78 0.00 0.00 1.2510 0.0000 250437.82 250437.82 0.00% 5401.56 5401.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 45.88 32 59 3699.31 2047 5546 3699.37 3457 3948 169732 169732 0.00%
crit 19.19% 10.89 3 21 7408.94 4095 11091 7403.19 5802 9106 80706 80706 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.36
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.69
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1646 16.5% 26.9 10.76sec 18410 14589 Direct 34.2 1568 3135 1871 19.2%
Periodic 348.3 1041 2082 1239 19.0% 95.8%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.92 34.20 348.30 348.30 1.2619 2.4839 495516.11 495516.11 0.00% 551.11 14589.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 27.62 16 41 1568.26 819 2218 1568.58 1440 1706 43302 43302 0.00%
crit 19.24% 6.58 0 15 3135.29 1647 4435 3128.20 0 3900 20639 20639 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.96% 281.99 209 353 1040.86 0 1387 1040.96 1022 1061 293513 293513 0.00%
crit 19.04% 66.31 41 101 2082.18 1 2773 2082.12 1932 2190 138063 138063 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:18.16
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.85
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 623 6.3% 44.6 6.14sec 4204 2869 Direct 55.1 (55.1) 2859 5702 3406 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.62 55.06 0.00 0.00 1.4652 0.0000 187599.00 187599.00 0.00% 2869.45 2869.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 44.46 25 65 2858.80 1322 3768 2862.02 2631 3136 127102 127102 0.00%
crit 19.26% 10.60 2 23 5702.22 2663 7536 5710.60 4621 6762 60497 60497 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:34.00
    havoc
    [R]:10.89
  • if_expr:cast_time<havoc_remains
Rain of Fire 935 9.4% 17.4 16.55sec 16125 12931 Periodic 412.9 570 1139 680 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.41 0.00 0.00 412.94 1.2471 0.0000 280760.63 280760.63 0.00% 12930.53 12930.53
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 333.11 220 446 569.83 507 659 570.01 560 584 189817 189817 0.00%
crit 19.33% 79.82 50 126 1139.26 1013 1318 1139.64 1109 1195 90944 90944 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.30
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.12
Soul Fire 530 5.3% 5.6 49.33sec 28576 8217 Direct 7.8 16933 33956 20379 20.3%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.58 7.81 0.00 0.00 3.4775 0.0000 159468.16 159468.16 0.00% 8217.47 8217.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.67% 6.22 2 11 16932.77 8614 23280 17000.75 14305 21118 105457 105457 0.00%
crit 20.33% 1.59 0 6 33955.79 17232 46472 28061.09 0 45896 54011 54011 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.37
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.31
  • if_expr:cast_time<havoc_remains
Soul Rot 352 3.5% 5.3 62.27sec 19977 15984 Periodic 97.2 914 1827 1090 19.3% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 0.00 97.24 97.24 1.2500 1.2897 106035.43 106035.43 0.00% 803.04 15983.63
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.69% 78.46 46 100 914.24 424 1535 914.10 857 984 71712 71712 0.00%
crit 19.31% 18.78 8 34 1827.26 849 3069 1825.68 1385 2355 34323 34323 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.31
Summon Infernal 85 0.8% 2.0 180.63sec 12602 10902 Direct 6.0 3515 7034 4201 19.5%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 25205.00 25205.00 0.00% 10901.81 10901.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.52% 4.83 2 6 3515.22 3348 3683 3515.47 3348 3683 16982 16982 0.00%
crit 19.48% 1.17 0 4 7033.75 6696 7366 5128.29 0 7366 8223 8223 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3821 / 772
Immolation 3555 7.1% 39.0 5.49sec 5469 0 Direct 117.0 1529 3057 1823 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213292.00 213292.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 94.51 79 107 1529.36 1395 2023 1529.28 1487 1566 144540 144540 0.00%
crit 19.22% 22.49 10 38 3057.00 2790 4046 3056.57 2790 3404 68752 68752 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.5% 41.0 5.25sec 390 271 Direct 41.0 326 651 390 19.7%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15974.90 22818.55 29.99% 271.20 271.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.32% 32.93 24 39 325.55 326 326 325.55 326 326 10720 15313 29.99%
crit 19.68% 8.07 2 17 651.10 651 651 651.10 651 651 5255 7506 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 513 / 513
Firebolt 513 5.1% 93.6 3.21sec 1647 1131 Direct 92.9 1395 2790 1659 18.9%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.58 92.89 0.00 0.00 1.4562 0.0000 154132.58 154132.58 0.00% 1131.05 1131.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.06% 75.30 53 97 1395.06 1395 1395 1395.06 1395 1395 105050 105050 0.00%
crit 18.94% 17.59 6 30 2790.11 2790 2790 2790.11 2790 2790 49083 49083 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:94.02
Simple Action Stats Execute Interval
NightFae_Koraylon
Havoc 9.7 32.03sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.68 0.00 0.00 0.00 1.2445 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.69
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.1 0.0 8.0sec 8.0sec 4.1sec 50.32% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 23.3s
  • trigger_min/max:2.0s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.32%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soul Rot 5.3 0.0 62.4sec 62.4sec 7.9sec 13.93% 0.00% 0.0 (0.0) 5.2

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.4s
  • trigger_min/max:61.3s / 68.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 8.0s

Stack Uptimes

  • soul_rot_1:13.93%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.1s
  • trigger_min/max:180.0s / 185.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.1s
  • trigger_min/max:180.0s / 185.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.21% 11.31% 17.74% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Koraylon
soul_fire Soul Shard 6.59 7.23 7.59% 1.10 0.66 8.33%
immolate Soul Shard 348.29 33.69 35.38% 0.10 1.13 3.26%
incinerate Soul Shard 44.67 11.09 11.65% 0.25 0.00 0.03%
conflagrate Soul Shard 37.05 28.38 29.79% 0.77 0.00 0.00%
mana_regen Mana 660.62 116099.62 100.00% 175.74 34095.36 22.70%
immolate_crits Soul Shard 33.31 3.23 3.39% 0.10 0.10 3.07%
incinerate_crits Soul Shard 10.62 1.06 1.11% 0.10 0.00 0.03%
infernal Soul Shard 120.00 10.55 11.08% 0.09 1.45 12.06%
pet - imp
energy_regen Energy 362.19 3571.98 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 385.60 388.20 34143.6 49219.0 47896.0 50000.0
Soul Shard 4.0 0.32 0.32 3.3 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Koraylon
cataclysm Mana 9.7 4860.0 500.0 500.4 49.4
channel_demonfire Mana 12.1 9051.3 750.0 749.3 35.1
chaos_bolt Soul Shard 21.9 43.7 2.0 2.0 12600.6
conflagrate Mana 37.0 18524.1 500.0 499.8 13.5
havoc Mana 9.7 9685.8 1000.0 1000.7 0.0
immolate Mana 26.9 20171.9 750.0 749.5 24.6
incinerate Mana 44.7 44670.3 1000.0 1001.1 4.2
rain_of_fire Soul Shard 17.4 52.3 3.0 3.0 5371.0
soul_fire Mana 6.6 6589.4 1000.0 1180.8 24.2
soul_rot Mana 5.3 1325.0 250.0 249.6 80.0
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.6
pet - imp
firebolt Energy 93.6 3742.8 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
NightFae_Koraylon Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
NightFae_Koraylon Damage Per Second
Count 627
Mean 9978.23
Minimum 9457.66
Maximum 10618.00
Spread ( max - min ) 1160.34
Range [ ( max - min ) / 2 * 100% ] 5.81%
Standard Deviation 225.7474
5th Percentile 9653.56
95th Percentile 10388.02
( 95th Percentile - 5th Percentile ) 734.46
Mean Distribution
Standard Deviation 9.0155
95.00% Confidence Interval ( 9960.56 - 9995.90 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1967
0.1 Scale Factor Error with Delta=300 436
0.05 Scale Factor Error with Delta=300 1741
0.01 Scale Factor Error with Delta=300 43504
Priority Target DPS
NightFae_Koraylon Priority Target Damage Per Second
Count 627
Mean 5386.71
Minimum 5010.38
Maximum 5885.08
Spread ( max - min ) 874.70
Range [ ( max - min ) / 2 * 100% ] 8.12%
Standard Deviation 134.7059
5th Percentile 5179.71
95th Percentile 5616.87
( 95th Percentile - 5th Percentile ) 437.17
Mean Distribution
Standard Deviation 5.3796
95.00% Confidence Interval ( 5376.17 - 5397.26 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2403
0.1 Scale Factor Error with Delta=300 155
0.05 Scale Factor Error with Delta=300 620
0.01 Scale Factor Error with Delta=300 15491
DPS(e)
NightFae_Koraylon Damage Per Second (Effective)
Count 627
Mean 9978.23
Minimum 9457.66
Maximum 10618.00
Spread ( max - min ) 1160.34
Range [ ( max - min ) / 2 * 100% ] 5.81%
Damage
NightFae_Koraylon Damage
Count 627
Mean 2613719.85
Minimum 2083188.08
Maximum 3158544.70
Spread ( max - min ) 1075356.62
Range [ ( max - min ) / 2 * 100% ] 20.57%
DTPS
NightFae_Koraylon Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Koraylon Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Koraylon Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Koraylon Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Koraylon Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Koraylon Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_KoraylonTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Koraylon Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.37 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.78 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.30 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.31 soul_rot
F 12.07 channel_demonfire,if=dot.immolate.remains>cast_time
G 18.16 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.69 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.12 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.36 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 34.00 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.69 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.31 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.85 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.00 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.89 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDGFGGDLKLLKDALLKIQQRNPQ9FGGKJLKLLAEINQQRPNFJLLGKLLLLJA9FINQNQNPRJGLLKFLEAJKLIQRNPQRF9GGJKLKALLINQQPNQFLGGGMKDELKADIOQNQRNDFDGGGKLLLAINQQNQPFLKLG9GEGJKAIQNQRRNPFGJLGKLLLJKLAIQRNOPFJKLJGKELLLLA

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E soul_rot Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.748 aoe F channel_demonfire Fluffy_Pillow 49624.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:04.902 cds M summon_infernal Fluffy_Pillow 49951.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot
0:05.908 aoe I havoc enemy2 49454.0/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot
0:06.914 havoc Q chaos_bolt Fluffy_Pillow 48957.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:08.923 havoc N conflagrate Fluffy_Pillow 49961.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:09.929 havoc Q chaos_bolt Fluffy_Pillow 49964.5/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot
0:11.335 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:12.342 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:13.351 havoc Q chaos_bolt Fluffy_Pillow 49253.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:14.757 havoc N conflagrate Fluffy_Pillow 49956.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:15.764 havoc Q chaos_bolt Fluffy_Pillow 49960.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:17.172 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:18.180 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:19.187 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:20.193 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.0/5: 40% soul_shard
bloodlust, backdraft
0:22.436 aoe G immolate enemy2 49623.5/50000: 99% mana
2.7/5: 54% soul_shard
bloodlust, backdraft
0:23.443 aoe G immolate enemy3 49252.5/50000: 99% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:24.451 aoe D rain_of_fire Fluffy_Pillow 49006.5/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:25.457 aoe L incinerate Fluffy_Pillow 49509.5/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft
0:26.396 aoe K conflagrate Fluffy_Pillow 48979.0/50000: 98% mana
0.9/5: 18% soul_shard
bloodlust
0:27.403 aoe L incinerate Fluffy_Pillow 48982.5/50000: 98% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:28.342 aoe L incinerate Fluffy_Pillow 48452.0/50000: 97% mana
2.3/5: 46% soul_shard
bloodlust
0:29.682 aoe K conflagrate Fluffy_Pillow 48122.0/50000: 96% mana
3.0/5: 60% soul_shard
bloodlust
0:30.688 aoe D rain_of_fire Fluffy_Pillow 48125.0/50000: 96% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:31.696 default A cataclysm Fluffy_Pillow 48629.0/50000: 97% mana
1.2/5: 24% soul_shard
bloodlust, backdraft
0:33.077 aoe L incinerate Fluffy_Pillow 48819.5/50000: 98% mana
1.7/5: 34% soul_shard
bloodlust, backdraft
0:34.018 aoe L incinerate Fluffy_Pillow 48290.0/50000: 97% mana
2.3/5: 46% soul_shard
bloodlust
0:35.359 aoe K conflagrate Fluffy_Pillow 47960.5/50000: 96% mana
2.8/5: 56% soul_shard
bloodlust
0:36.543 aoe I havoc enemy2 48052.5/50000: 96% mana
3.8/5: 76% soul_shard
bloodlust, backdraft
0:37.551 havoc Q chaos_bolt Fluffy_Pillow 47556.5/50000: 95% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:38.957 havoc Q chaos_bolt Fluffy_Pillow 48259.5/50000: 97% mana
2.1/5: 42% soul_shard
bloodlust
0:40.965 havoc R incinerate Fluffy_Pillow 49263.5/50000: 99% mana
0.4/5: 8% soul_shard
bloodlust
0:42.305 havoc N conflagrate Fluffy_Pillow 48933.5/50000: 98% mana
1.0/5: 20% soul_shard
0:43.851 havoc P immolate Fluffy_Pillow 49206.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
0:45.156 havoc Q chaos_bolt Fluffy_Pillow 49109.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
0:46.984 default 9 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
0:50.462 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
0:53.366 aoe G immolate enemy3 49704.5/50000: 99% mana
2.5/5: 50% soul_shard
0:54.671 aoe G immolate enemy2 49251.5/50000: 99% mana
2.6/5: 52% soul_shard
0:55.977 aoe K conflagrate Fluffy_Pillow 49154.5/50000: 98% mana
2.8/5: 56% soul_shard
0:57.285 aoe J rain_of_fire Fluffy_Pillow 49308.5/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
0:58.591 aoe L incinerate Fluffy_Pillow 49961.5/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
0:59.809 aoe K conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
0.9/5: 18% soul_shard
1:01.150 aoe L incinerate Fluffy_Pillow 49172.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
1:02.369 aoe L incinerate Fluffy_Pillow 48781.5/50000: 98% mana
1.9/5: 38% soul_shard
1:04.108 default A cataclysm Fluffy_Pillow 48651.0/50000: 97% mana
2.3/5: 46% soul_shard
1:05.847 aoe E soul_rot Fluffy_Pillow 49020.5/50000: 98% mana
2.5/5: 50% soul_shard
1:07.154 aoe I havoc enemy2 49424.0/50000: 99% mana
2.6/5: 52% soul_shard
soul_rot
1:08.461 havoc N conflagrate Fluffy_Pillow 49077.5/50000: 98% mana
2.8/5: 56% soul_shard
soul_rot
1:09.800 havoc Q chaos_bolt Fluffy_Pillow 49247.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft, soul_rot
1:11.629 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
soul_rot
1:14.239 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
soul_rot
1:15.980 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
1:17.286 havoc N conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
1.4/5: 28% soul_shard
1:18.595 aoe F channel_demonfire Fluffy_Pillow 49060.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:21.451 aoe J rain_of_fire Fluffy_Pillow 49738.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
1:22.757 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.1/5: 2% soul_shard
backdraft
1:23.977 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.5/5: 10% soul_shard
1:25.717 aoe G immolate enemy3 48872.5/50000: 98% mana
0.8/5: 16% soul_shard
1:27.023 aoe K conflagrate Fluffy_Pillow 48775.5/50000: 98% mana
1.1/5: 22% soul_shard
1:28.327 aoe L incinerate Fluffy_Pillow 48927.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
1:29.546 aoe L incinerate Fluffy_Pillow 48537.0/50000: 97% mana
2.1/5: 42% soul_shard
1:31.287 aoe L incinerate Fluffy_Pillow 48407.5/50000: 97% mana
2.5/5: 50% soul_shard
1:33.028 aoe L incinerate Fluffy_Pillow 48278.0/50000: 97% mana
2.9/5: 58% soul_shard
1:34.768 aoe J rain_of_fire Fluffy_Pillow 48148.0/50000: 96% mana
3.6/5: 72% soul_shard
1:36.075 default A cataclysm Fluffy_Pillow 48801.5/50000: 98% mana
0.6/5: 12% soul_shard
1:37.816 default 9 soul_fire Fluffy_Pillow 49172.0/50000: 98% mana
1.1/5: 22% soul_shard
1:41.295 aoe F channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
2.5/5: 50% soul_shard
1:44.046 aoe I havoc enemy2 49628.5/50000: 99% mana
2.8/5: 56% soul_shard
1:45.353 havoc N conflagrate Fluffy_Pillow 49282.0/50000: 99% mana
2.9/5: 58% soul_shard
1:46.659 havoc Q chaos_bolt Fluffy_Pillow 49435.0/50000: 99% mana
4.1/5: 82% soul_shard
backdraft
1:48.486 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
1:49.793 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:51.620 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
1:53.043 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
1:54.352 havoc R incinerate Fluffy_Pillow 49253.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
1:55.571 aoe J rain_of_fire Fluffy_Pillow 48863.0/50000: 98% mana
3.6/5: 72% soul_shard
1:56.877 aoe G immolate enemy3 49516.0/50000: 99% mana
0.7/5: 14% soul_shard
1:58.183 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.0/5: 20% soul_shard
1:59.924 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
2:01.666 aoe K conflagrate Fluffy_Pillow 48873.5/50000: 98% mana
1.8/5: 36% soul_shard
2:02.972 aoe F channel_demonfire Fluffy_Pillow 49026.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:05.766 aoe L incinerate Fluffy_Pillow 49673.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft
2:06.986 aoe E soul_rot Fluffy_Pillow 49002.5/50000: 98% mana
3.1/5: 62% soul_shard
2:08.456 default A cataclysm Fluffy_Pillow 49487.5/50000: 99% mana
3.3/5: 66% soul_shard
soul_rot
2:10.197 aoe J rain_of_fire Fluffy_Pillow 49502.5/50000: 99% mana
3.6/5: 72% soul_shard
soul_rot
2:11.504 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
soul_rot
2:12.810 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
backdraft, soul_rot
2:14.030 aoe I havoc enemy2 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
soul_rot
2:15.350 havoc Q chaos_bolt Fluffy_Pillow 48662.5/50000: 97% mana
2.0/5: 40% soul_shard
soul_rot
2:17.958 havoc R incinerate Fluffy_Pillow 49966.5/50000: 100% mana
0.3/5: 6% soul_shard
2:19.699 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
2:21.006 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
2:22.312 havoc Q chaos_bolt Fluffy_Pillow 49059.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:24.139 havoc R incinerate Fluffy_Pillow 49972.5/50000: 100% mana
0.6/5: 12% soul_shard
2:25.879 aoe F channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:28.757 default 9 soul_fire Fluffy_Pillow 49691.0/50000: 99% mana
1.5/5: 30% soul_shard
2:32.235 aoe G immolate enemy3 49002.5/50000: 98% mana
3.1/5: 62% soul_shard
2:33.540 aoe G immolate enemy2 48905.0/50000: 98% mana
3.4/5: 68% soul_shard
2:34.846 aoe J rain_of_fire Fluffy_Pillow 48808.0/50000: 98% mana
3.5/5: 70% soul_shard
2:36.152 aoe K conflagrate Fluffy_Pillow 49461.0/50000: 99% mana
0.7/5: 14% soul_shard
2:37.460 aoe L incinerate Fluffy_Pillow 49615.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
2:38.680 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
2:39.986 default A cataclysm Fluffy_Pillow 49155.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:41.933 aoe L incinerate Fluffy_Pillow 49502.5/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
2:43.151 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
2.9/5: 58% soul_shard
2:44.892 aoe I havoc enemy2 48872.0/50000: 98% mana
3.3/5: 66% soul_shard
2:46.197 havoc N conflagrate Fluffy_Pillow 48524.5/50000: 97% mana
3.6/5: 72% soul_shard
2:47.503 havoc Q chaos_bolt Fluffy_Pillow 48677.5/50000: 97% mana
4.8/5: 96% soul_shard
backdraft
2:49.332 havoc Q chaos_bolt Fluffy_Pillow 49592.0/50000: 99% mana
3.0/5: 60% soul_shard
2:51.941 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
2:53.248 havoc N conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.4/5: 28% soul_shard
2:54.555 havoc Q chaos_bolt Fluffy_Pillow 49406.0/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
2:56.383 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
2:59.223 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
3:00.964 aoe G immolate enemy3 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
3:02.270 aoe G immolate enemy2 48905.5/50000: 98% mana
1.8/5: 36% soul_shard
3:03.573 aoe G immolate Fluffy_Pillow 48807.0/50000: 98% mana
2.0/5: 40% soul_shard
3:04.880 cds M summon_infernal Fluffy_Pillow 48710.5/50000: 97% mana
2.2/5: 44% soul_shard
3:06.207 aoe K conflagrate Fluffy_Pillow 48374.0/50000: 97% mana
2.5/5: 50% soul_shard
3:07.513 aoe D rain_of_fire Fluffy_Pillow 48527.0/50000: 97% mana
3.6/5: 72% soul_shard
backdraft
3:08.821 aoe E soul_rot Fluffy_Pillow 49181.0/50000: 98% mana
0.9/5: 18% soul_shard
backdraft
3:10.127 aoe L incinerate Fluffy_Pillow 49584.0/50000: 99% mana
1.4/5: 28% soul_shard
backdraft, soul_rot
3:11.347 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.9/5: 38% soul_shard
soul_rot
3:12.654 default A cataclysm Fluffy_Pillow 49156.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, soul_rot
3:14.395 aoe D rain_of_fire Fluffy_Pillow 49502.5/50000: 99% mana
3.5/5: 70% soul_shard
backdraft, soul_rot
3:15.703 aoe I havoc enemy2 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
backdraft, soul_rot
3:17.010 havoc O soul_fire Fluffy_Pillow 49653.5/50000: 99% mana
1.5/5: 30% soul_shard
backdraft, soul_rot
3:20.707 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
4.6/5: 92% soul_shard
backdraft
3:22.534 havoc N conflagrate Fluffy_Pillow 49915.5/50000: 100% mana
3.0/5: 60% soul_shard
3:23.841 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
3:25.668 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:27.409 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
4.0/5: 80% soul_shard
3:28.715 aoe D rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:30.020 aoe F channel_demonfire Fluffy_Pillow 49808.0/50000: 100% mana
2.6/5: 52% soul_shard
backdraft
3:32.918 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
3:34.226 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
3:35.531 aoe G immolate enemy2 49251.5/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
3:36.836 aoe G immolate enemy3 49154.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
3:38.144 aoe K conflagrate Fluffy_Pillow 49058.0/50000: 98% mana
1.6/5: 32% soul_shard
3:39.451 aoe L incinerate Fluffy_Pillow 49211.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
3:40.671 aoe L incinerate Fluffy_Pillow 48821.5/50000: 98% mana
2.5/5: 50% soul_shard
3:42.413 aoe L incinerate Fluffy_Pillow 48692.5/50000: 97% mana
2.9/5: 58% soul_shard
3:44.154 default A cataclysm Fluffy_Pillow 48563.0/50000: 97% mana
3.3/5: 66% soul_shard
3:46.132 aoe I havoc enemy2 49052.0/50000: 98% mana
3.7/5: 74% soul_shard
3:47.438 havoc N conflagrate Fluffy_Pillow 48705.0/50000: 97% mana
3.8/5: 76% soul_shard
3:48.745 havoc Q chaos_bolt Fluffy_Pillow 48858.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:50.572 havoc Q chaos_bolt Fluffy_Pillow 49772.0/50000: 100% mana
3.0/5: 60% soul_shard
3:53.183 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
3:54.490 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
backdraft
3:56.318 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
3:57.624 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
4:00.371 aoe L incinerate Fluffy_Pillow 49875.5/50000: 100% mana
1.4/5: 28% soul_shard
4:02.110 aoe K conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.8/5: 36% soul_shard
4:03.416 aoe L incinerate Fluffy_Pillow 49154.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
4:04.635 aoe G immolate enemy3 48764.0/50000: 98% mana
2.8/5: 56% soul_shard
4:05.941 default 9 soul_fire Fluffy_Pillow 48667.0/50000: 97% mana
2.9/5: 58% soul_shard
4:09.420 aoe G immolate Fluffy_Pillow 49003.0/50000: 98% mana
4.4/5: 88% soul_shard
4:10.727 aoe E soul_rot Fluffy_Pillow 48906.5/50000: 98% mana
4.5/5: 90% soul_shard
4:12.035 aoe G immolate enemy2 49310.5/50000: 99% mana
4.7/5: 94% soul_shard
soul_rot
4:13.342 aoe J rain_of_fire Fluffy_Pillow 49214.0/50000: 98% mana
4.8/5: 96% soul_shard
soul_rot
4:14.646 aoe K conflagrate Fluffy_Pillow 49866.0/50000: 100% mana
2.0/5: 40% soul_shard
soul_rot
4:15.953 default A cataclysm Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
backdraft, soul_rot
4:17.867 aoe I havoc enemy2 49502.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, soul_rot
4:19.173 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, soul_rot
4:21.000 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
4:22.308 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft
4:24.137 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
4:25.877 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
4:27.618 havoc N conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
1.9/5: 38% soul_shard
4:28.924 havoc P immolate Fluffy_Pillow 49025.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
4:30.232 aoe F channel_demonfire Fluffy_Pillow 48929.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
4:33.035 aoe G immolate enemy2 49581.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
4:34.341 aoe J rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
4:35.648 aoe L incinerate Fluffy_Pillow 49905.5/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
4:36.868 aoe G immolate enemy3 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
4:38.173 aoe K conflagrate Fluffy_Pillow 48905.0/50000: 98% mana
1.3/5: 26% soul_shard
4:39.481 aoe L incinerate Fluffy_Pillow 49059.0/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
4:40.700 aoe L incinerate Fluffy_Pillow 48668.5/50000: 97% mana
2.4/5: 48% soul_shard
4:42.439 aoe L incinerate Fluffy_Pillow 48538.0/50000: 97% mana
2.8/5: 56% soul_shard
4:44.179 aoe J rain_of_fire Fluffy_Pillow 48408.0/50000: 97% mana
3.4/5: 68% soul_shard
4:45.485 aoe K conflagrate Fluffy_Pillow 49061.0/50000: 98% mana
0.6/5: 12% soul_shard
4:46.792 aoe L incinerate Fluffy_Pillow 49214.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
4:48.011 default A cataclysm Fluffy_Pillow 48824.0/50000: 98% mana
1.6/5: 32% soul_shard
4:49.750 aoe I havoc enemy2 49193.5/50000: 98% mana
2.0/5: 40% soul_shard
4:51.056 havoc Q chaos_bolt Fluffy_Pillow 48846.5/50000: 98% mana
2.1/5: 42% soul_shard
4:53.664 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
4:55.403 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.2/5: 24% soul_shard
4:56.708 havoc O soul_fire Fluffy_Pillow 49154.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
5:00.186 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
5:01.494 aoe F channel_demonfire Fluffy_Pillow 48906.5/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
5:04.302 aoe J rain_of_fire Fluffy_Pillow 49560.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
5:05.608 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
5:06.915 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
5:08.136 aoe J rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.2/5: 64% soul_shard
5:09.442 aoe G immolate enemy3 49656.0/50000: 99% mana
0.4/5: 8% soul_shard
5:10.747 aoe K conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
0.5/5: 10% soul_shard
5:12.053 aoe E soul_rot Fluffy_Pillow 49404.5/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
5:13.360 aoe L incinerate Fluffy_Pillow 49752.5/50000: 100% mana
1.3/5: 26% soul_shard
backdraft, soul_rot
5:14.579 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
soul_rot
5:16.320 aoe L incinerate Fluffy_Pillow 48872.5/50000: 98% mana
2.2/5: 44% soul_shard
soul_rot
5:18.060 aoe L incinerate Fluffy_Pillow 48742.5/50000: 97% mana
2.5/5: 50% soul_shard
soul_rot
5:19.799 default A cataclysm Fluffy_Pillow 48612.0/50000: 97% mana
3.0/5: 60% soul_shard
soul_rot

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Koraylon"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=325066/infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Koraylon_FS : 9986 dps, 5348 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9986.5 9986.5 17.4 / 0.175% 814.8 / 8.2% 22.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.4 386.0 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Koraylon_FS 9986
Cataclysm 816 8.2% 9.7 32.47sec 25237 14851 Direct 29.2 6872 13901 8413 21.9%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.72 29.16 0.00 0.00 1.6993 0.0000 245327.70 245327.70 0.00% 14851.24 14851.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.07% 22.77 12 33 6872.24 6142 7986 6870.92 6607 7123 156443 156443 0.00%
crit 21.93% 6.39 1 15 13901.02 12283 15973 13917.34 12553 15430 88885 88885 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.80
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1073) 0.0% (10.8%) 12.0 25.56sec 26800 9943

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.04 0.00 179.89 0.00 2.6952 0.1634 0.00 0.00 0.00% 9943.48 9943.48

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:12.04
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1073 10.8% 0.0 0.00sec 0 0 Direct 539.7 494 978 598 21.4%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 539.68 0.00 0.00 0.0000 0.0000 322536.80 322536.80 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.59% 424.14 300 555 493.98 263 1074 494.44 460 529 209544 209544 0.00%
crit 21.41% 115.54 74 165 977.65 525 2147 978.42 866 1152 112993 112993 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1346 (1828) 13.5% (18.3%) 21.8 13.06sec 25189 12863 Direct 43.4 (86.5) 0 9321 9321 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.80 43.39 0.00 0.00 1.9582 0.0000 404447.45 404447.45 0.00% 12863.13 12863.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.39 32 56 9321.31 5862 13465 9321.06 9069 9570 404447 404447 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.90
  • if_expr:cast_time<havoc_remains
    Internal Combustion 482 4.8% 43.1 13.07sec 3358 0 Direct 43.1 2816 5608 3358 19.4%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.07 43.07 0.00 0.00 0.0000 0.0000 144641.19 144641.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 34.70 23 50 2815.58 1 4495 2817.83 2563 3069 97714 97714 0.00%
crit 19.42% 8.37 1 19 5607.50 2 8989 5616.36 4081 7270 46927 46927 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 831 8.3% 37.0 7.96sec 6744 5391 Direct 56.8 3702 7359 4396 19.0%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.05 56.84 0.00 0.00 1.2510 0.0000 249852.19 249852.19 0.00% 5390.90 5390.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.04% 46.06 27 61 3702.34 2047 5546 3702.29 3472 3978 170485 170485 0.00%
crit 18.96% 10.78 3 21 7359.42 4095 11091 7361.41 5116 9960 79367 79367 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.26
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.77
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1656 16.6% 26.8 10.64sec 18591 14734 Direct 34.0 1570 3140 1878 19.7%
Periodic 348.4 1041 2082 1247 19.8% 95.8%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.81 33.99 348.40 348.40 1.2617 2.4835 498326.80 498326.80 0.00% 554.27 14734.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.31% 27.30 16 40 1569.65 819 2218 1570.15 1467 1702 42851 42851 0.00%
crit 19.69% 6.69 0 19 3139.79 1640 4437 3134.02 0 3838 21016 21016 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.25% 279.59 207 347 1041.46 0 1387 1041.67 1024 1061 291219 291219 0.00%
crit 19.75% 68.81 43 102 2081.77 4 2773 2081.63 1983 2195 143242 143242 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:18.11
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.81
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 628 6.3% 44.8 6.22sec 4218 2878 Direct 55.4 (55.4) 2857 5712 3412 19.4% (19.4%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.83 55.44 0.00 0.00 1.4655 0.0000 189130.90 189130.90 0.00% 2878.44 2878.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 44.67 22 64 2857.00 1317 3768 2858.51 2661 3085 127598 127598 0.00%
crit 19.43% 10.77 2 23 5712.10 2630 7535 5715.57 4568 6759 61533 61533 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:34.12
    havoc
    [R]:10.97
  • if_expr:cast_time<havoc_remains
Rain of Fire 939 9.4% 17.5 16.78sec 16110 12924 Periodic 414.8 570 1140 680 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.51 0.00 0.00 414.83 1.2466 0.0000 282057.84 282057.84 0.00% 12923.61 12923.61
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.70% 334.77 218 455 570.08 507 659 570.19 561 582 190832 190832 0.00%
crit 19.30% 80.06 43 125 1139.54 1013 1318 1139.73 1110 1175 91226 91226 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.34
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.16
Soul Fire 528 5.3% 5.6 49.48sec 28522 8202 Direct 7.9 16945 33748 20185 19.2%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.57 7.88 0.00 0.00 3.4775 0.0000 158942.52 158942.52 0.00% 8202.22 8202.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 6.37 2 10 16945.23 8605 23293 16993.99 13393 21060 107930 107930 0.00%
crit 19.21% 1.51 0 6 33747.79 17359 46484 27303.54 0 46484 51012 51012 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.32
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.36
  • if_expr:cast_time<havoc_remains
Soul Rot 359 3.6% 5.3 62.40sec 20393 16316 Periodic 97.1 912 1846 1112 21.5% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.30 0.00 97.14 97.14 1.2499 1.2899 108012.99 108012.99 0.00% 818.81 16316.16
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 78.55% 76.30 46 99 911.67 424 1535 911.53 856 961 69545 69545 0.00%
crit 21.45% 20.84 8 36 1845.98 849 3069 1846.19 1446 2316 38468 38468 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.31
Summon Infernal 95 0.9% 2.0 180.63sec 14114 12210 Direct 6.0 3482 7164 4709 33.2%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 28228.46 28228.46 0.00% 12209.54 12209.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.80% 4.01 1 6 3482.42 3348 3683 3477.01 3348 3683 13958 13958 0.00%
crit 33.20% 1.99 0 5 7163.71 6696 7366 6621.14 0 7366 14270 14270 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3530 / 713
Immolation 3263 6.5% 39.0 5.49sec 5020 0 Direct 117.0 1395 2790 1673 19.9%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 195768.44 195768.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.06% 93.67 82 107 1395.06 1395 1395 1395.06 1395 1395 130675 130675 0.00%
crit 19.94% 23.33 10 35 2790.11 2790 2790 2790.11 2790 2790 65094 65094 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 267 0.5% 41.0 5.25sec 391 272 Direct 41.0 326 651 391 20.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16028.90 22895.68 29.99% 272.12 272.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.91% 32.76 25 39 325.55 326 326 325.55 326 326 10666 15236 29.99%
crit 20.09% 8.24 2 16 651.10 651 651 651.10 651 651 5363 7660 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 520 / 520
Firebolt 520 5.2% 93.6 3.21sec 1672 1148 Direct 92.9 1395 2790 1684 20.7%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.58 92.89 0.00 0.00 1.4562 0.0000 156435.42 156435.42 0.00% 1147.95 1147.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.29% 73.65 53 95 1395.06 1395 1395 1395.06 1395 1395 102747 102747 0.00%
crit 20.71% 19.24 9 33 2790.11 2790 2790 2790.11 2790 2790 53689 53689 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:94.02
Simple Action Stats Execute Interval
NightFae_Koraylon_FS
Havoc 9.7 32.12sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.67 0.00 0.00 0.00 1.2445 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.67
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.0 0.0 8.0sec 8.0sec 4.1sec 50.44% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:NightFae_Koraylon_FS
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.2s
  • trigger_min/max:2.1s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.44%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Koraylon_FS
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
First Strike 1.0 2.0 0.0sec 0.0sec 6.7sec 2.27% 0.00% 2.0 (2.0) 1.0

Buff Details

  • buff initial source:NightFae_Koraylon_FS
  • cooldown name:buff_first_strike
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:6.7s / 6.7s

Stack Uptimes

  • first_strike_1:2.27%

Spelldata

  • id:325381
  • name:First Strike
  • tooltip:Critical Strike increased by $w%.
  • description:{$@spelldesc325069=Damaging an enemy before they damage you increases your chance to critical strike by {$325381s1=25}% for {$325381d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Soul Rot 5.3 0.0 62.4sec 62.4sec 7.9sec 13.92% 0.00% 0.0 (0.0) 5.2

Buff Details

  • buff initial source:NightFae_Koraylon_FS
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 69.1s
  • trigger_min/max:61.3s / 69.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • soul_rot_1:13.92%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon_FS_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 187.5s
  • trigger_min/max:180.0s / 187.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon_FS_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 187.5s
  • trigger_min/max:180.0s / 187.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.25% 10.47% 17.58% 0.9s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Koraylon_FS
soul_fire Soul Shard 6.58 7.18 7.53% 1.09 0.75 9.46%
immolate Soul Shard 348.36 33.70 35.34% 0.10 1.14 3.27%
incinerate Soul Shard 44.86 11.15 11.69% 0.25 0.01 0.06%
conflagrate Soul Shard 37.03 28.40 29.78% 0.77 0.00 0.00%
mana_regen Mana 660.69 116184.17 100.00% 175.85 33986.46 22.63%
immolate_crits Soul Shard 34.40 3.33 3.50% 0.10 0.10 3.05%
incinerate_crits Soul Shard 10.78 1.08 1.13% 0.10 0.00 0.09%
infernal Soul Shard 120.00 10.53 11.04% 0.09 1.47 12.25%
pet - imp
energy_regen Energy 362.19 3571.98 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 385.97 388.45 34006.9 49253.5 47742.5 50000.0
Soul Shard 4.0 0.32 0.32 3.5 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Koraylon_FS
cataclysm Mana 9.7 4863.9 500.0 500.4 50.4
channel_demonfire Mana 12.0 9028.0 750.0 750.1 35.7
chaos_bolt Soul Shard 21.8 43.6 2.0 2.0 12605.8
conflagrate Mana 37.0 18516.3 500.0 499.8 13.5
havoc Mana 9.7 9668.7 1000.0 999.7 0.0
immolate Mana 26.8 20092.5 750.0 749.6 24.8
incinerate Mana 44.9 44860.0 1000.0 1000.6 4.2
rain_of_fire Soul Shard 17.5 52.5 3.0 3.0 5370.9
soul_fire Mana 6.6 6581.6 1000.0 1181.1 24.1
soul_rot Mana 5.3 1322.3 250.0 249.7 81.7
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 14.1
pet - imp
firebolt Energy 93.6 3742.8 40.0 40.0 41.8

Statistics & Data Analysis

Fight Length
NightFae_Koraylon_FS Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
NightFae_Koraylon_FS Damage Per Second
Count 627
Mean 9986.49
Minimum 9417.33
Maximum 10779.56
Spread ( max - min ) 1362.23
Range [ ( max - min ) / 2 * 100% ] 6.82%
Standard Deviation 222.7242
5th Percentile 9648.68
95th Percentile 10379.03
( 95th Percentile - 5th Percentile ) 730.35
Mean Distribution
Standard Deviation 8.8947
95.00% Confidence Interval ( 9969.05 - 10003.92 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1911
0.1 Scale Factor Error with Delta=300 424
0.05 Scale Factor Error with Delta=300 1694
0.01 Scale Factor Error with Delta=300 42347
Priority Target DPS
NightFae_Koraylon_FS Priority Target Damage Per Second
Count 627
Mean 5347.78
Minimum 5026.06
Maximum 5786.47
Spread ( max - min ) 760.42
Range [ ( max - min ) / 2 * 100% ] 7.11%
Standard Deviation 127.3797
5th Percentile 5150.77
95th Percentile 5573.05
( 95th Percentile - 5th Percentile ) 422.28
Mean Distribution
Standard Deviation 5.0871
95.00% Confidence Interval ( 5337.80 - 5357.75 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2180
0.1 Scale Factor Error with Delta=300 139
0.05 Scale Factor Error with Delta=300 555
0.01 Scale Factor Error with Delta=300 13852
DPS(e)
NightFae_Koraylon_FS Damage Per Second (Effective)
Count 627
Mean 9986.49
Minimum 9417.33
Maximum 10779.56
Spread ( max - min ) 1362.23
Range [ ( max - min ) / 2 * 100% ] 6.82%
Damage
NightFae_Koraylon_FS Damage
Count 627
Mean 2631504.85
Minimum 2109572.07
Maximum 3195087.78
Spread ( max - min ) 1085515.71
Range [ ( max - min ) / 2 * 100% ] 20.63%
DTPS
NightFae_Koraylon_FS Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Koraylon_FS Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Koraylon_FS Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Koraylon_FS Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Koraylon_FS Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Koraylon_FS Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_Koraylon_FSTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Koraylon_FS Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.32 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.80 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.34 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.31 soul_rot
F 12.04 channel_demonfire,if=dot.immolate.remains>cast_time
G 18.11 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.67 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.16 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.26 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 34.12 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.77 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.36 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.81 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.90 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.97 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGGDLKLLDKALLKFIQQPONJLGKLJFKLAELLINQQPNQFGLGGKLL9AJINQNQRPFKJLGLKLLLEJAINQRRNPR9FJGKJLKLLLAINQQRNPFLJLGKMLLDE9AFIQNQNPQNDLLGGFGJKLAKIQNQRRPN9FGJEKJLLKAIQRRNQPFLKLJGLGKGLL9AFIQNQNPQNJELGLF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.739 aoe E soul_rot Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, first_strike
0:02.745 aoe F channel_demonfire Fluffy_Pillow 49622.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot, first_strike
0:05.075 cds M summon_infernal Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot, first_strike
0:06.082 aoe I havoc enemy2 49503.5/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot, first_strike
0:07.089 havoc Q chaos_bolt Fluffy_Pillow 49007.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:09.097 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:10.103 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot
0:11.510 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:12.516 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:13.522 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:14.931 havoc N conflagrate Fluffy_Pillow 49956.5/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:15.937 havoc Q chaos_bolt Fluffy_Pillow 49959.5/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:17.342 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:18.347 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:19.356 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:21.720 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:22.727 aoe G immolate enemy2 49252.5/50000: 99% mana
2.7/5: 54% soul_shard
bloodlust, backdraft
0:23.734 aoe G immolate enemy3 49006.0/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:24.741 aoe D rain_of_fire Fluffy_Pillow 48759.5/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:25.748 aoe L incinerate Fluffy_Pillow 49263.0/50000: 99% mana
0.7/5: 14% soul_shard
bloodlust, backdraft
0:26.690 aoe K conflagrate Fluffy_Pillow 48734.0/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust
0:27.697 aoe L incinerate Fluffy_Pillow 48737.5/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:28.635 aoe L incinerate Fluffy_Pillow 48206.5/50000: 96% mana
2.5/5: 50% soul_shard
bloodlust
0:29.974 aoe D rain_of_fire Fluffy_Pillow 47876.0/50000: 96% mana
3.2/5: 64% soul_shard
bloodlust
0:30.980 aoe K conflagrate Fluffy_Pillow 48379.0/50000: 97% mana
0.5/5: 10% soul_shard
bloodlust
0:31.987 default A cataclysm Fluffy_Pillow 48382.5/50000: 97% mana
1.4/5: 28% soul_shard
bloodlust, backdraft
0:33.328 aoe L incinerate Fluffy_Pillow 48553.0/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:34.267 aoe L incinerate Fluffy_Pillow 48022.5/50000: 96% mana
2.4/5: 48% soul_shard
bloodlust
0:35.606 aoe K conflagrate Fluffy_Pillow 47692.0/50000: 95% mana
3.0/5: 60% soul_shard
bloodlust
0:36.717 aoe F channel_demonfire Fluffy_Pillow 47747.5/50000: 95% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:39.042 aoe I havoc enemy2 48160.0/50000: 96% mana
4.1/5: 82% soul_shard
bloodlust, backdraft
0:40.048 havoc Q chaos_bolt Fluffy_Pillow 47663.0/50000: 95% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:41.454 havoc Q chaos_bolt Fluffy_Pillow 48366.0/50000: 97% mana
2.4/5: 48% soul_shard
0:44.063 havoc P immolate Fluffy_Pillow 49670.5/50000: 99% mana
0.7/5: 14% soul_shard
0:45.371 havoc O soul_fire Fluffy_Pillow 49253.0/50000: 99% mana
0.9/5: 18% soul_shard
0:48.847 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
3.4/5: 68% soul_shard
0:50.154 aoe J rain_of_fire Fluffy_Pillow 49155.0/50000: 98% mana
4.6/5: 92% soul_shard
backdraft
0:51.459 aoe L incinerate Fluffy_Pillow 49807.5/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
0:52.680 aoe G immolate enemy3 49003.0/50000: 98% mana
2.1/5: 42% soul_shard
0:53.986 aoe K conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
2.2/5: 44% soul_shard
0:55.291 aoe L incinerate Fluffy_Pillow 49058.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
0:56.508 aoe J rain_of_fire Fluffy_Pillow 48667.0/50000: 97% mana
3.2/5: 64% soul_shard
0:57.814 aoe F channel_demonfire Fluffy_Pillow 49320.0/50000: 99% mana
0.4/5: 8% soul_shard
1:00.676 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
1:01.983 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
backdraft
1:03.203 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
1:05.066 aoe E soul_rot Fluffy_Pillow 49434.0/50000: 99% mana
1.9/5: 38% soul_shard
1:06.373 aoe L incinerate Fluffy_Pillow 49752.5/50000: 100% mana
2.3/5: 46% soul_shard
soul_rot
1:08.113 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
soul_rot
1:09.854 aoe I havoc enemy2 48872.5/50000: 98% mana
3.0/5: 60% soul_shard
soul_rot
1:11.161 havoc N conflagrate Fluffy_Pillow 48526.0/50000: 97% mana
3.2/5: 64% soul_shard
soul_rot
1:12.469 havoc Q chaos_bolt Fluffy_Pillow 48680.0/50000: 97% mana
4.3/5: 86% soul_shard
backdraft, soul_rot
1:14.298 havoc Q chaos_bolt Fluffy_Pillow 49594.5/50000: 99% mana
2.6/5: 52% soul_shard
soul_rot
1:16.910 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
1:18.218 havoc N conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.1/5: 22% soul_shard
1:19.522 havoc Q chaos_bolt Fluffy_Pillow 49405.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
1:21.350 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
1:24.204 aoe G immolate enemy3 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
1:25.510 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
1:27.249 aoe G immolate Fluffy_Pillow 49001.5/50000: 98% mana
1.4/5: 28% soul_shard
1:28.555 aoe G immolate enemy2 48904.5/50000: 98% mana
1.4/5: 28% soul_shard
1:29.861 aoe K conflagrate Fluffy_Pillow 48807.5/50000: 98% mana
1.7/5: 34% soul_shard
1:31.170 aoe L incinerate Fluffy_Pillow 48962.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
1:32.389 aoe L incinerate Fluffy_Pillow 48571.5/50000: 97% mana
2.7/5: 54% soul_shard
1:34.129 default 9 soul_fire Fluffy_Pillow 48441.5/50000: 97% mana
3.2/5: 64% soul_shard
1:37.606 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
4.8/5: 96% soul_shard
1:39.347 aoe J rain_of_fire Fluffy_Pillow 49372.5/50000: 99% mana
5.0/5: 100% soul_shard
1:40.654 aoe I havoc enemy2 50000.0/50000: 100% mana
2.1/5: 42% soul_shard
1:41.960 havoc N conflagrate Fluffy_Pillow 49653.0/50000: 99% mana
2.3/5: 46% soul_shard
1:43.266 havoc Q chaos_bolt Fluffy_Pillow 49806.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:45.093 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
1:46.399 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
1:48.226 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
1:49.967 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
1:51.275 aoe F channel_demonfire Fluffy_Pillow 48906.5/50000: 98% mana
1.8/5: 36% soul_shard
1:54.138 aoe K conflagrate Fluffy_Pillow 49588.0/50000: 99% mana
2.2/5: 44% soul_shard
1:55.446 aoe J rain_of_fire Fluffy_Pillow 49742.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
1:56.754 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.1/5: 2% soul_shard
backdraft
1:57.973 aoe G immolate enemy3 49002.0/50000: 98% mana
0.5/5: 10% soul_shard
1:59.280 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
0.6/5: 12% soul_shard
2:01.020 aoe K conflagrate Fluffy_Pillow 48775.5/50000: 98% mana
1.2/5: 24% soul_shard
2:02.327 aoe L incinerate Fluffy_Pillow 48929.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
2:03.548 aoe L incinerate Fluffy_Pillow 48539.5/50000: 97% mana
2.2/5: 44% soul_shard
2:05.290 aoe L incinerate Fluffy_Pillow 48410.5/50000: 97% mana
2.8/5: 56% soul_shard
2:07.031 aoe E soul_rot Fluffy_Pillow 48281.0/50000: 97% mana
3.1/5: 62% soul_shard
2:08.337 aoe J rain_of_fire Fluffy_Pillow 48684.0/50000: 97% mana
3.4/5: 68% soul_shard
soul_rot
2:09.642 default A cataclysm Fluffy_Pillow 49336.5/50000: 99% mana
0.5/5: 10% soul_shard
soul_rot
2:11.381 aoe I havoc enemy2 49501.5/50000: 99% mana
1.0/5: 20% soul_shard
soul_rot
2:12.689 havoc N conflagrate Fluffy_Pillow 49155.5/50000: 98% mana
1.0/5: 20% soul_shard
soul_rot
2:13.993 havoc Q chaos_bolt Fluffy_Pillow 49307.5/50000: 99% mana
2.4/5: 48% soul_shard
backdraft, soul_rot
2:15.821 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
soul_rot
2:17.562 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
2:19.303 havoc N conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
1.9/5: 38% soul_shard
2:20.609 havoc P immolate Fluffy_Pillow 49026.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
2:21.917 havoc R incinerate Fluffy_Pillow 48930.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
2:23.137 default 9 soul_fire Fluffy_Pillow 48540.0/50000: 97% mana
3.7/5: 74% soul_shard
2:26.613 aoe F channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
2:29.360 aoe J rain_of_fire Fluffy_Pillow 49625.0/50000: 99% mana
5.0/5: 100% soul_shard
2:30.667 aoe G immolate enemy3 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
2:31.973 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.3/5: 46% soul_shard
2:33.280 aoe J rain_of_fire Fluffy_Pillow 49405.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
2:34.587 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.1/5: 2% soul_shard
backdraft
2:35.806 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.6/5: 12% soul_shard
2:37.114 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.1/5: 22% soul_shard
backdraft
2:38.334 aoe L incinerate Fluffy_Pillow 48766.0/50000: 98% mana
1.7/5: 34% soul_shard
2:40.074 aoe L incinerate Fluffy_Pillow 48636.0/50000: 97% mana
2.3/5: 46% soul_shard
2:41.816 default A cataclysm Fluffy_Pillow 48507.0/50000: 97% mana
2.5/5: 50% soul_shard
2:43.556 aoe I havoc enemy2 48877.0/50000: 98% mana
2.9/5: 58% soul_shard
2:44.863 havoc N conflagrate Fluffy_Pillow 48530.5/50000: 97% mana
2.9/5: 58% soul_shard
2:46.169 havoc Q chaos_bolt Fluffy_Pillow 48683.5/50000: 97% mana
4.2/5: 84% soul_shard
backdraft
2:47.995 havoc Q chaos_bolt Fluffy_Pillow 49596.5/50000: 99% mana
2.4/5: 48% soul_shard
2:50.604 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
2:52.344 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:53.813 havoc P immolate Fluffy_Pillow 49236.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:55.118 aoe F channel_demonfire Fluffy_Pillow 49139.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:57.950 aoe L incinerate Fluffy_Pillow 49805.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
2:59.171 aoe J rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.2/5: 64% soul_shard
3:00.478 aoe L incinerate Fluffy_Pillow 49656.5/50000: 99% mana
0.3/5: 6% soul_shard
3:02.218 aoe G immolate enemy3 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
3:03.524 aoe K conflagrate Fluffy_Pillow 48905.0/50000: 98% mana
1.1/5: 22% soul_shard
3:04.830 cds M summon_infernal Fluffy_Pillow 49058.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
3:06.382 aoe L incinerate Fluffy_Pillow 48834.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
3:07.602 aoe L incinerate Fluffy_Pillow 48444.0/50000: 97% mana
2.6/5: 52% soul_shard
3:09.343 aoe D rain_of_fire Fluffy_Pillow 48314.5/50000: 97% mana
3.4/5: 68% soul_shard
3:10.651 aoe E soul_rot Fluffy_Pillow 48968.5/50000: 98% mana
0.7/5: 14% soul_shard
3:11.959 default 9 soul_fire Fluffy_Pillow 49372.5/50000: 99% mana
1.2/5: 24% soul_shard
soul_rot
3:15.437 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
3.3/5: 66% soul_shard
soul_rot
3:17.178 aoe F channel_demonfire Fluffy_Pillow 49373.0/50000: 99% mana
3.8/5: 76% soul_shard
soul_rot
3:20.013 aoe I havoc enemy2 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
3:21.320 havoc Q chaos_bolt Fluffy_Pillow 49653.5/50000: 99% mana
4.9/5: 98% soul_shard
3:23.929 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:25.236 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft
3:27.063 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:28.369 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:29.676 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.9/5: 98% soul_shard
backdraft
3:31.504 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:32.811 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft
3:34.115 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft
3:35.335 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.7/5: 54% soul_shard
3:37.073 aoe G immolate enemy3 48871.5/50000: 98% mana
2.9/5: 58% soul_shard
3:38.380 aoe G immolate enemy2 48775.0/50000: 98% mana
3.2/5: 64% soul_shard
3:39.686 aoe F channel_demonfire Fluffy_Pillow 48678.0/50000: 97% mana
3.3/5: 66% soul_shard
3:42.446 aoe G immolate Fluffy_Pillow 49308.0/50000: 99% mana
3.6/5: 72% soul_shard
3:43.751 aoe J rain_of_fire Fluffy_Pillow 49210.5/50000: 98% mana
4.1/5: 82% soul_shard
3:45.056 aoe K conflagrate Fluffy_Pillow 49863.0/50000: 100% mana
1.1/5: 22% soul_shard
3:46.363 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft
3:47.583 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
3:49.321 aoe K conflagrate Fluffy_Pillow 49371.5/50000: 99% mana
2.5/5: 50% soul_shard
3:50.630 aoe I havoc enemy2 49526.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
3:51.936 havoc Q chaos_bolt Fluffy_Pillow 49179.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
3:53.763 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
3:55.070 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
backdraft
3:56.897 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
3:58.638 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
4:00.377 havoc P immolate Fluffy_Pillow 48872.0/50000: 98% mana
2.1/5: 42% soul_shard
4:01.684 havoc N conflagrate Fluffy_Pillow 48775.5/50000: 98% mana
2.3/5: 46% soul_shard
4:03.004 default 9 soul_fire Fluffy_Pillow 48935.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
4:06.483 aoe F channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
4:09.291 aoe G immolate enemy3 49657.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
4:10.598 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
4:11.904 aoe E soul_rot Fluffy_Pillow 49905.5/50000: 100% mana
2.2/5: 44% soul_shard
4:13.258 aoe K conflagrate Fluffy_Pillow 49751.5/50000: 100% mana
2.3/5: 46% soul_shard
soul_rot
4:14.565 aoe J rain_of_fire Fluffy_Pillow 49905.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft, soul_rot
4:15.872 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft, soul_rot
4:17.091 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.6/5: 12% soul_shard
soul_rot
4:18.833 aoe K conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
0.9/5: 18% soul_shard
soul_rot
4:20.302 default A cataclysm Fluffy_Pillow 49107.5/50000: 98% mana
1.8/5: 36% soul_shard
backdraft, soul_rot
4:22.042 aoe I havoc enemy2 49477.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
4:23.349 havoc Q chaos_bolt Fluffy_Pillow 49131.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
4:25.177 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
4:26.918 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
4:28.659 havoc N conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
1.6/5: 32% soul_shard
4:29.964 havoc Q chaos_bolt Fluffy_Pillow 49025.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
4:31.792 havoc P immolate Fluffy_Pillow 49939.5/50000: 100% mana
0.9/5: 18% soul_shard
4:33.098 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.2/5: 24% soul_shard
4:36.012 aoe L incinerate Fluffy_Pillow 49959.0/50000: 100% mana
1.7/5: 34% soul_shard
4:37.751 aoe K conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
2.1/5: 42% soul_shard
4:39.058 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
4:40.277 aoe J rain_of_fire Fluffy_Pillow 48764.5/50000: 98% mana
3.1/5: 62% soul_shard
4:41.582 aoe G immolate enemy3 49417.0/50000: 99% mana
0.2/5: 4% soul_shard
4:42.889 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.5/5: 10% soul_shard
4:44.631 aoe G immolate enemy2 49003.0/50000: 98% mana
0.8/5: 16% soul_shard
4:45.938 aoe K conflagrate Fluffy_Pillow 48906.5/50000: 98% mana
1.0/5: 20% soul_shard
4:47.244 aoe G immolate Fluffy_Pillow 49059.5/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
4:48.550 aoe L incinerate Fluffy_Pillow 48962.5/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
4:49.770 aoe L incinerate Fluffy_Pillow 48572.5/50000: 97% mana
2.3/5: 46% soul_shard
4:51.509 default 9 soul_fire Fluffy_Pillow 48442.0/50000: 97% mana
2.8/5: 56% soul_shard
4:54.988 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
4.1/5: 82% soul_shard
4:56.730 aoe F channel_demonfire Fluffy_Pillow 49374.0/50000: 99% mana
4.4/5: 88% soul_shard
4:59.587 aoe I havoc enemy2 50000.0/50000: 100% mana
4.7/5: 94% soul_shard
5:00.893 havoc Q chaos_bolt Fluffy_Pillow 49653.0/50000: 99% mana
4.8/5: 96% soul_shard
5:03.502 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
5:04.810 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
5:06.639 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
5:07.945 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
5:09.252 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
3.7/5: 74% soul_shard
backdraft
5:11.078 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
5:12.385 aoe J rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft
5:13.690 aoe E soul_rot Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
5:14.997 aoe L incinerate Fluffy_Pillow 49752.5/50000: 100% mana
0.5/5: 10% soul_shard
backdraft, soul_rot
5:16.218 aoe G immolate enemy3 49003.0/50000: 98% mana
0.7/5: 14% soul_shard
soul_rot
5:17.523 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
0.9/5: 18% soul_shard
soul_rot
5:19.264 aoe F channel_demonfire Fluffy_Pillow 48776.0/50000: 98% mana
1.3/5: 26% soul_shard
soul_rot

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Koraylon_FS"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=325069/325066/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Niya : 10032 dps, 5411 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10031.9 10031.9 17.5 / 0.175% 842.9 / 8.4% 22.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.8 386.1 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Niya 10032
Cataclysm 799 8.0% 9.7 32.26sec 24692 14530 Direct 29.2 6885 13823 8227 19.4%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.73 29.19 0.00 0.00 1.6994 0.0000 240220.73 240220.73 0.00% 14529.77 14529.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 23.53 14 33 6885.18 6142 8105 6884.77 6631 7200 162063 162063 0.00%
crit 19.37% 5.65 0 13 13823.30 12283 16331 13804.61 0 15673 78157 78157 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.79
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1062) 0.0% (10.6%) 12.0 25.78sec 26550 9856

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.03 0.00 179.75 0.00 2.6939 0.1634 0.00 0.00 0.00% 9855.55 9855.55

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:12.03
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1062 10.6% 0.0 0.00sec 0 0 Direct 539.3 496 993 592 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 539.26 0.00 0.00 0.0000 0.0000 319359.17 319359.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 435.20 315 562 496.27 263 1108 496.67 467 522 215998 215998 0.00%
crit 19.30% 104.07 57 147 993.27 525 2180 993.84 873 1133 103361 103361 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1357 (1824) 13.5% (18.2%) 21.7 13.56sec 25249 12886 Direct 43.2 (86.0) 0 9439 9439 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.69 43.17 0.00 0.00 1.9595 0.0000 407463.67 407463.67 0.00% 12885.57 12885.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.17 32 58 9439.20 5915 13603 9438.52 9158 9710 407464 407464 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.80
  • if_expr:cast_time<havoc_remains
    Internal Combustion 467 4.7% 42.8 13.55sec 3278 0 Direct 42.8 2742 5506 3278 19.4%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.78 42.78 0.00 0.00 0.0000 0.0000 140250.29 140250.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 34.48 23 51 2742.01 1 4080 2744.65 2538 3001 94553 94553 0.00%
crit 19.39% 8.30 1 17 5505.86 227 8151 5529.88 3529 7839 45697 45697 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 845 8.4% 37.1 7.95sec 6854 5479 Direct 56.8 3743 7496 4473 19.5%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.05 56.77 0.00 0.00 1.2509 0.0000 253959.45 253959.45 0.00% 5479.17 5479.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.53% 45.72 31 61 3742.72 2047 5681 3742.57 3513 4051 171093 171093 0.00%
crit 19.47% 11.05 3 24 7495.66 4095 11232 7493.41 5348 9184 82867 82867 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.32
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.72
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1674 16.7% 26.8 10.92sec 18781 14885 Direct 34.0 1598 3200 1909 19.4%
Periodic 348.4 1056 2113 1260 19.3% 95.8%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.82 33.96 348.36 348.36 1.2618 2.4844 503744.51 503744.51 0.00% 560.14 14885.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 27.37 16 39 1598.14 821 2256 1598.82 1466 1733 43736 43736 0.00%
crit 19.41% 6.59 1 14 3200.11 1657 4537 3201.58 2284 4347 21102 21102 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.72% 281.20 211 349 1056.03 1 1432 1056.10 1027 1081 296967 296967 0.00%
crit 19.28% 67.16 41 97 2113.48 2 2830 2113.47 1986 2216 141939 141939 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:18.11
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.84
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 639 6.4% 44.9 6.07sec 4287 2926 Direct 55.6 (55.6) 2902 5799 3459 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.92 55.64 0.00 0.00 1.4650 0.0000 192549.66 192549.66 0.00% 2926.24 2926.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 44.91 27 69 2902.18 1329 3827 2904.15 2666 3129 130341 130341 0.00%
crit 19.28% 10.73 1 23 5798.97 2684 7582 5791.76 4378 6754 62208 62208 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:34.05
    havoc
    [R]:11.12
  • if_expr:cast_time<havoc_remains
Rain of Fire 956 9.5% 17.6 16.06sec 16337 13103 Periodic 417.3 576 1152 688 19.5% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.58 0.00 0.00 417.31 1.2469 0.0000 287212.35 287212.35 0.00% 13102.75 13102.75
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.55% 336.13 219 464 576.16 507 680 576.15 566 587 193669 193669 0.00%
crit 19.45% 81.18 47 118 1152.27 1013 1361 1152.27 1119 1193 93544 93544 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.35
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.21
Soul Fire 524 5.2% 5.6 49.43sec 28319 8144 Direct 7.9 16857 33449 20027 19.0%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.57 7.88 0.00 0.00 3.4775 0.0000 157721.26 157721.26 0.00% 8143.81 8143.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.00% 6.38 2 11 16857.16 8625 23401 16918.79 13872 20650 107670 107670 0.00%
crit 19.00% 1.50 0 6 33448.88 17431 46665 27045.30 0 46509 50051 50051 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.31
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.36
  • if_expr:cast_time<havoc_remains
Soul Rot 341 3.4% 5.3 62.45sec 19342 15475 Periodic 97.1 882 1771 1057 19.6% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 0.00 97.12 97.12 1.2500 1.2895 102662.03 102662.03 0.00% 778.53 15475.13
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.35% 78.04 51 100 882.29 424 1395 882.31 822 944 68840 68840 0.00%
crit 19.65% 19.08 6 35 1771.14 849 2790 1772.72 1340 2322 33822 33822 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.32
Summon Infernal 81 0.8% 2.0 180.75sec 11996 10377 Direct 6.0 3348 6696 3996 19.4%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23992.30 23992.30 0.00% 10377.29 10377.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 4.83 2 6 3348.13 3348 3348 3348.13 3348 3348 16185 16185 0.00%
crit 19.43% 1.17 0 4 6696.27 6696 6696 4976.81 0 6696 7807 7807 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3821 / 772
Immolation 3555 7.1% 39.0 5.50sec 5470 0 Direct 117.0 1529 3059 1824 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213328.35 213328.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 94.50 82 105 1529.14 1395 2023 1529.11 1491 1558 144504 144504 0.00%
crit 19.23% 22.50 12 35 3058.83 2790 4046 3058.47 2814 3320 68825 68825 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.26sec 388 270 Direct 41.0 326 651 388 19.2%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15913.63 22731.04 29.99% 270.16 270.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 33.12 22 40 325.55 326 326 325.55 326 326 10782 15401 29.99%
crit 19.22% 7.88 1 19 651.10 651 651 651.10 651 651 5132 7331 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 515 / 515
Firebolt 515 5.1% 93.6 3.21sec 1655 1137 Direct 92.9 1395 2790 1668 19.5%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.58 92.89 0.00 0.00 1.4562 0.0000 154877.94 154877.94 0.00% 1136.51 1136.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.49% 74.77 54 95 1395.06 1395 1395 1395.06 1395 1395 104304 104304 0.00%
crit 19.51% 18.13 6 33 2790.11 2790 2790 2790.11 2790 2790 50574 50574 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:94.02
Simple Action Stats Execute Interval
NightFae_Niya
Havoc 9.7 31.89sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.69 0.00 0.00 0.00 1.2446 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.69
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.1 0.0 8.0sec 8.0sec 4.1sec 50.54% 0.00% 0.0 (0.0) 1.5

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.1s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.0s

Stack Uptimes

  • backdraft_1:50.54%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Redirected Anima 16.4 0.0 46.6sec 18.4sec 59.3sec 84.87% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_redirected_anima
  • max_stacks:50
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:25.00

Trigger Details

  • interval_min/max:0.0s / 285.9s
  • trigger_min/max:0.0s / 64.4s
  • trigger_pct:99.21%
  • duration_min/max:0.0s / 290.6s

Stack Uptimes

  • redirected_anima_1:20.51%
  • redirected_anima_2:10.07%
  • redirected_anima_3:3.11%
  • redirected_anima_4:0.82%
  • redirected_anima_5:0.13%
  • redirected_anima_6:0.03%
  • redirected_anima_7:0.01%
  • redirected_anima_8:16.83%
  • redirected_anima_9:20.25%
  • redirected_anima_10:9.15%
  • redirected_anima_11:3.13%
  • redirected_anima_12:0.74%
  • redirected_anima_13:0.18%
  • redirected_anima_14:0.16%
  • redirected_anima_15:0.06%
  • redirected_anima_16:0.13%

Spelldata

  • id:342814
  • name:Redirected Anima
  • tooltip:Max health increased by $w1%. Mastery increased by $w2.
  • description:{$@spelldesc322721=Healing or dealing damage has a chance to grant you a stack of Redirected Anima. Redirected Anima increases your maximum health by {$342814s1=1}% and your Mastery by {$342814s2=25} for {$342814d=30 seconds}, and stacks overlap. $?(s152280&a137005)[Defile]?(a137005&!s152280)[Death's Due]?a212611[The Hunt]?a137009[Convoke the Spirits]?a137014[Wild Spirits]?a137018[Shifting Power]?a137022[Faeline Stomp]?a137026[Blessing of Seasons]?a137030[Fae Guardians]?a137034[Sepsis]?a137038[Fae Transfusion]?a137042[Soul Rot]?a137047[Ancient Aftershock][Activating your Night Fae class ability] grants you ${{$s3=8}*$<mod>} stacks of Redirected Anima.}
  • max_stacks:50
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Soul Rot 5.3 0.0 62.4sec 62.4sec 7.9sec 13.92% 0.00% 0.0 (0.0) 5.2

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.2s
  • trigger_min/max:61.3s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • soul_rot_1:13.92%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 187.4s
  • trigger_min/max:180.0s / 187.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 187.4s
  • trigger_min/max:180.0s / 187.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.25% 11.13% 17.75% 0.9s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Niya
soul_fire Soul Shard 6.58 7.21 7.56% 1.10 0.72 9.05%
immolate Soul Shard 348.33 33.71 35.34% 0.10 1.12 3.22%
incinerate Soul Shard 44.93 11.19 11.73% 0.25 0.01 0.09%
conflagrate Soul Shard 37.03 28.37 29.74% 0.77 0.00 0.00%
mana_regen Mana 661.18 116237.93 100.00% 175.80 33930.16 22.59%
immolate_crits Soul Shard 33.63 3.26 3.42% 0.10 0.10 3.07%
incinerate_crits Soul Shard 10.70 1.07 1.12% 0.10 0.00 0.06%
infernal Soul Shard 120.00 10.59 11.10% 0.09 1.41 11.76%
pet - imp
energy_regen Energy 362.19 3571.98 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.15 388.82 33953.4 49195.7 47800.0 50000.0
Soul Shard 4.0 0.32 0.32 3.4 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Niya
cataclysm Mana 9.7 4867.8 500.0 500.3 49.3
channel_demonfire Mana 12.0 9023.3 750.0 750.1 35.4
chaos_bolt Soul Shard 21.7 43.4 2.0 2.0 12632.0
conflagrate Mana 37.0 18517.1 500.0 499.8 13.7
havoc Mana 9.7 9690.5 1000.0 1000.3 0.0
immolate Mana 26.8 20113.5 750.0 749.9 25.0
incinerate Mana 44.9 44930.0 1000.0 1000.3 4.3
rain_of_fire Soul Shard 17.6 52.7 3.0 3.0 5450.6
soul_fire Mana 6.6 6580.1 1000.0 1181.5 24.0
soul_rot Mana 5.3 1325.0 250.0 249.6 77.5
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.6 3742.8 40.0 40.0 41.4

Statistics & Data Analysis

Fight Length
NightFae_Niya Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
NightFae_Niya Damage Per Second
Count 627
Mean 10031.94
Minimum 9456.27
Maximum 10627.48
Spread ( max - min ) 1171.20
Range [ ( max - min ) / 2 * 100% ] 5.84%
Standard Deviation 223.6586
5th Percentile 9707.98
95th Percentile 10419.05
( 95th Percentile - 5th Percentile ) 711.06
Mean Distribution
Standard Deviation 8.9321
95.00% Confidence Interval ( 10014.43 - 10049.44 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1910
0.1 Scale Factor Error with Delta=300 428
0.05 Scale Factor Error with Delta=300 1709
0.01 Scale Factor Error with Delta=300 42703
Priority Target DPS
NightFae_Niya Priority Target Damage Per Second
Count 627
Mean 5410.59
Minimum 5065.07
Maximum 5809.49
Spread ( max - min ) 744.41
Range [ ( max - min ) / 2 * 100% ] 6.88%
Standard Deviation 127.3326
5th Percentile 5221.72
95th Percentile 5627.48
( 95th Percentile - 5th Percentile ) 405.76
Mean Distribution
Standard Deviation 5.0852
95.00% Confidence Interval ( 5400.62 - 5420.56 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2128
0.1 Scale Factor Error with Delta=300 139
0.05 Scale Factor Error with Delta=300 554
0.01 Scale Factor Error with Delta=300 13841
DPS(e)
NightFae_Niya Damage Per Second (Effective)
Count 627
Mean 10031.94
Minimum 9456.27
Maximum 10627.48
Spread ( max - min ) 1171.20
Range [ ( max - min ) / 2 * 100% ] 5.84%
Damage
NightFae_Niya Damage
Count 627
Mean 2629135.42
Minimum 2094499.85
Maximum 3183032.26
Spread ( max - min ) 1088532.41
Range [ ( max - min ) / 2 * 100% ] 20.70%
DTPS
NightFae_Niya Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Niya Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Niya Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Niya Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Niya Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Niya Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_NiyaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Niya Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.31 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.79 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.35 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.32 soul_rot
F 12.03 channel_demonfire,if=dot.immolate.remains>cast_time
G 18.11 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.69 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.21 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.32 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 34.05 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.72 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.36 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.84 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.80 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.12 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDGFGGDLKLLKDALLKIQRQRNPQ9FGGJKLKEALINQQRPNFJLLGKLLJLKA9FINQQRNPLGJLKLFEAKJLLIRNQRQP9FGKJLKALLKIQRQPRNFGJGLMKELDAKL9FIQNQNPQDGKLLLFAJKLLINQPRQRN9EFGGJAKLJIRNQRNPRFGJKLLKJLLALINOQQNFLJEGGGKLLK

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E soul_rot Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.748 aoe F channel_demonfire Fluffy_Pillow 49624.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:04.896 cds M summon_infernal Fluffy_Pillow 49948.0/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, soul_rot, redirected_anima(8)
0:05.902 aoe I havoc enemy2 49451.0/50000: 99% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot, redirected_anima(8)
0:06.908 havoc Q chaos_bolt Fluffy_Pillow 48954.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot, redirected_anima(8)
0:08.916 havoc N conflagrate Fluffy_Pillow 49958.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot, redirected_anima(8)
0:09.922 havoc Q chaos_bolt Fluffy_Pillow 49961.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot, redirected_anima(8)
0:11.329 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, redirected_anima(8)
0:12.336 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:13.344 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:14.748 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust, redirected_anima(9)
0:15.754 havoc Q chaos_bolt Fluffy_Pillow 49958.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:17.162 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, redirected_anima(9)
0:18.168 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:19.174 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:20.181 aoe F channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
1.9/5: 38% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:22.527 aoe G immolate enemy2 49675.5/50000: 99% mana
2.6/5: 52% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:23.532 aoe G immolate enemy3 49251.5/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:24.539 aoe D rain_of_fire Fluffy_Pillow 49005.0/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:25.545 aoe L incinerate Fluffy_Pillow 49508.0/50000: 99% mana
0.4/5: 8% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:26.485 aoe K conflagrate Fluffy_Pillow 48978.0/50000: 98% mana
0.9/5: 18% soul_shard
bloodlust, redirected_anima(10)
0:27.492 aoe L incinerate Fluffy_Pillow 48981.5/50000: 98% mana
1.7/5: 34% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:28.433 aoe L incinerate Fluffy_Pillow 48452.0/50000: 97% mana
2.3/5: 46% soul_shard
bloodlust, redirected_anima(10)
0:29.772 aoe K conflagrate Fluffy_Pillow 48121.5/50000: 96% mana
3.0/5: 60% soul_shard
bloodlust, redirected_anima(10)
0:30.779 aoe D rain_of_fire Fluffy_Pillow 48125.0/50000: 96% mana
3.8/5: 76% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:31.788 default A cataclysm Fluffy_Pillow 48629.5/50000: 97% mana
1.2/5: 24% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:33.128 aoe L incinerate Fluffy_Pillow 48799.5/50000: 98% mana
1.6/5: 32% soul_shard
bloodlust, backdraft, redirected_anima(2)
0:34.070 aoe L incinerate Fluffy_Pillow 48270.5/50000: 97% mana
2.3/5: 46% soul_shard
bloodlust, redirected_anima(2)
0:35.411 aoe K conflagrate Fluffy_Pillow 47941.0/50000: 96% mana
2.8/5: 56% soul_shard
bloodlust, redirected_anima(3)
0:36.535 aoe I havoc enemy2 48003.0/50000: 96% mana
3.5/5: 70% soul_shard
bloodlust, backdraft, redirected_anima(3)
0:37.540 havoc Q chaos_bolt Fluffy_Pillow 47505.5/50000: 95% mana
3.6/5: 72% soul_shard
bloodlust, backdraft, redirected_anima(3)
0:38.945 havoc R incinerate Fluffy_Pillow 48208.0/50000: 96% mana
1.9/5: 38% soul_shard
bloodlust, redirected_anima(3)
0:40.286 havoc Q chaos_bolt Fluffy_Pillow 47878.5/50000: 96% mana
2.5/5: 50% soul_shard
bloodlust, redirected_anima(3)
0:42.295 havoc R incinerate Fluffy_Pillow 48883.0/50000: 98% mana
0.8/5: 16% soul_shard
redirected_anima(2)
0:44.033 havoc N conflagrate Fluffy_Pillow 48752.0/50000: 98% mana
1.3/5: 26% soul_shard
redirected_anima(3)
0:45.338 havoc P immolate Fluffy_Pillow 48904.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, redirected_anima(3)
0:46.645 havoc Q chaos_bolt Fluffy_Pillow 48808.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, redirected_anima(3)
0:48.472 default 9 soul_fire Fluffy_Pillow 49721.5/50000: 99% mana
1.1/5: 22% soul_shard
redirected_anima(3)
0:51.950 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.7/5: 54% soul_shard
redirected_anima(3)
0:54.826 aoe G immolate enemy3 49690.5/50000: 99% mana
3.1/5: 62% soul_shard
redirected_anima(2)
0:56.132 aoe G immolate enemy2 49252.0/50000: 99% mana
3.3/5: 66% soul_shard
redirected_anima(2)
0:57.439 aoe J rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.5/5: 70% soul_shard
redirected_anima(2)
0:58.747 aoe K conflagrate Fluffy_Pillow 49809.5/50000: 100% mana
0.6/5: 12% soul_shard
redirected_anima(2)
1:00.055 aoe L incinerate Fluffy_Pillow 49963.5/50000: 100% mana
1.4/5: 28% soul_shard
backdraft, redirected_anima(2)
1:01.275 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
redirected_anima(2)
1:02.582 aoe E soul_rot Fluffy_Pillow 49156.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, redirected_anima(2)
1:04.049 default A cataclysm Fluffy_Pillow 49639.5/50000: 99% mana
2.5/5: 50% soul_shard
backdraft, soul_rot, redirected_anima(2)
1:05.788 aoe L incinerate Fluffy_Pillow 49501.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft, soul_rot, redirected_anima(9)
1:07.007 aoe I havoc enemy2 49002.0/50000: 98% mana
3.1/5: 62% soul_shard
soul_rot, redirected_anima(9)
1:08.313 havoc N conflagrate Fluffy_Pillow 48655.0/50000: 97% mana
3.3/5: 66% soul_shard
soul_rot, redirected_anima(9)
1:09.789 havoc Q chaos_bolt Fluffy_Pillow 48893.0/50000: 98% mana
4.4/5: 88% soul_shard
backdraft, soul_rot, redirected_anima(9)
1:11.615 havoc Q chaos_bolt Fluffy_Pillow 49806.0/50000: 100% mana
2.8/5: 56% soul_shard
soul_rot, redirected_anima(9)
1:14.225 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
redirected_anima(8)
1:15.967 havoc P immolate Fluffy_Pillow 49003.0/50000: 98% mana
1.7/5: 34% soul_shard
redirected_anima(8)
1:17.273 havoc N conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
1.9/5: 38% soul_shard
redirected_anima(8)
1:18.580 aoe F channel_demonfire Fluffy_Pillow 49059.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft, redirected_anima(8)
1:21.434 aoe J rain_of_fire Fluffy_Pillow 49736.5/50000: 99% mana
3.5/5: 70% soul_shard
backdraft, redirected_anima(9)
1:22.740 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft, redirected_anima(9)
1:23.959 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
redirected_anima(9)
1:25.700 aoe G immolate enemy3 48872.5/50000: 98% mana
1.3/5: 26% soul_shard
redirected_anima(9)
1:27.006 aoe K conflagrate Fluffy_Pillow 48775.5/50000: 98% mana
1.6/5: 32% soul_shard
redirected_anima(9)
1:28.311 aoe L incinerate Fluffy_Pillow 48928.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, redirected_anima(9)
1:29.531 aoe L incinerate Fluffy_Pillow 48538.0/50000: 97% mana
2.6/5: 52% soul_shard
redirected_anima(9)
1:31.271 aoe J rain_of_fire Fluffy_Pillow 48408.0/50000: 97% mana
3.0/5: 60% soul_shard
redirected_anima(9)
1:32.578 aoe L incinerate Fluffy_Pillow 49061.5/50000: 98% mana
0.1/5: 2% soul_shard
redirected_anima(9)
1:34.318 aoe K conflagrate Fluffy_Pillow 48931.5/50000: 98% mana
0.5/5: 10% soul_shard
redirected_anima
1:35.737 default A cataclysm Fluffy_Pillow 49141.0/50000: 98% mana
1.1/5: 22% soul_shard
backdraft, redirected_anima
1:37.524 default 9 soul_fire Fluffy_Pillow 49501.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft, redirected_anima
1:41.002 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, redirected_anima
1:43.940 aoe I havoc enemy2 49721.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft, redirected_anima
1:45.248 havoc N conflagrate Fluffy_Pillow 49375.5/50000: 99% mana
3.4/5: 68% soul_shard
redirected_anima(2)
1:46.555 havoc Q chaos_bolt Fluffy_Pillow 49529.0/50000: 99% mana
4.6/5: 92% soul_shard
backdraft, redirected_anima(2)
1:48.383 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima(2)
1:50.993 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
redirected_anima
1:52.734 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
redirected_anima
1:54.040 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, redirected_anima
1:55.347 aoe L incinerate Fluffy_Pillow 49059.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, redirected_anima
1:56.565 aoe G immolate enemy3 48668.0/50000: 97% mana
3.3/5: 66% soul_shard
redirected_anima
1:57.873 aoe J rain_of_fire Fluffy_Pillow 48572.0/50000: 97% mana
3.3/5: 66% soul_shard
redirected_anima
1:59.180 aoe L incinerate Fluffy_Pillow 49225.5/50000: 98% mana
0.7/5: 14% soul_shard
redirected_anima
2:00.920 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
redirected_anima
2:02.228 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft, redirected_anima
2:03.447 aoe F channel_demonfire Fluffy_Pillow 48765.5/50000: 98% mana
2.1/5: 42% soul_shard
redirected_anima
2:06.282 aoe E soul_rot Fluffy_Pillow 49433.0/50000: 99% mana
2.5/5: 50% soul_shard
redirected_anima
2:07.586 default A cataclysm Fluffy_Pillow 49751.0/50000: 100% mana
2.5/5: 50% soul_shard
soul_rot, redirected_anima
2:09.324 aoe K conflagrate Fluffy_Pillow 49501.0/50000: 99% mana
2.8/5: 56% soul_shard
soul_rot, redirected_anima(9)
2:10.629 aoe J rain_of_fire Fluffy_Pillow 49653.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft, soul_rot, redirected_anima(9)
2:11.936 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft, soul_rot, redirected_anima(9)
2:13.155 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
soul_rot, redirected_anima(9)
2:14.894 aoe I havoc enemy2 48871.5/50000: 98% mana
1.4/5: 28% soul_shard
soul_rot, redirected_anima(8)
2:16.202 havoc R incinerate Fluffy_Pillow 48525.5/50000: 97% mana
1.6/5: 32% soul_shard
redirected_anima(8)
2:17.941 havoc N conflagrate Fluffy_Pillow 48395.0/50000: 97% mana
2.2/5: 44% soul_shard
redirected_anima(8)
2:19.246 havoc Q chaos_bolt Fluffy_Pillow 48547.5/50000: 97% mana
3.6/5: 72% soul_shard
backdraft, redirected_anima(8)
2:21.074 havoc R incinerate Fluffy_Pillow 49461.5/50000: 99% mana
1.6/5: 32% soul_shard
redirected_anima(8)
2:22.816 havoc Q chaos_bolt Fluffy_Pillow 49003.0/50000: 98% mana
2.3/5: 46% soul_shard
redirected_anima(8)
2:25.426 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
redirected_anima(8)
2:26.733 default 9 soul_fire Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
redirected_anima(8)
2:30.210 aoe F channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
redirected_anima(8)
2:32.978 aoe G immolate enemy3 49636.0/50000: 99% mana
2.9/5: 58% soul_shard
redirected_anima(8)
2:34.285 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.9/5: 58% soul_shard
redirected_anima(8)
2:35.590 aoe J rain_of_fire Fluffy_Pillow 49405.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft, redirected_anima(8)
2:36.896 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, redirected_anima(8)
2:38.117 aoe K conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.1/5: 22% soul_shard
redirected_anima
2:39.423 default A cataclysm Fluffy_Pillow 49156.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft, redirected_anima
2:41.162 aoe L incinerate Fluffy_Pillow 49501.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft, redirected_anima
2:42.381 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
redirected_anima
2:44.121 aoe K conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.6/5: 52% soul_shard
redirected_anima
2:45.427 aoe I havoc enemy2 49025.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, redirected_anima
2:46.735 havoc Q chaos_bolt Fluffy_Pillow 48679.0/50000: 97% mana
3.4/5: 68% soul_shard
backdraft, redirected_anima
2:48.563 havoc R incinerate Fluffy_Pillow 49593.0/50000: 99% mana
1.6/5: 32% soul_shard
redirected_anima
2:50.302 havoc Q chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
2.2/5: 44% soul_shard
redirected_anima(2)
2:52.911 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
redirected_anima(2)
2:54.218 havoc R incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.7/5: 14% soul_shard
redirected_anima(2)
2:55.958 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
redirected_anima(3)
2:57.263 aoe F channel_demonfire Fluffy_Pillow 49154.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, redirected_anima(3)
3:00.090 aoe G immolate enemy3 49818.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft, redirected_anima(3)
3:01.395 aoe J rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft, redirected_anima(3)
3:02.700 aoe G immolate enemy2 49904.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft, redirected_anima(3)
3:04.005 aoe L incinerate Fluffy_Pillow 49251.5/50000: 99% mana
0.4/5: 8% soul_shard
backdraft, redirected_anima(3)
3:05.224 cds M summon_infernal Fluffy_Pillow 48861.0/50000: 98% mana
0.7/5: 14% soul_shard
redirected_anima(3)
3:06.529 aoe K conflagrate Fluffy_Pillow 48513.5/50000: 97% mana
1.1/5: 22% soul_shard
redirected_anima(3)
3:07.836 aoe E soul_rot Fluffy_Pillow 48667.0/50000: 97% mana
2.0/5: 40% soul_shard
backdraft, redirected_anima(2)
3:09.144 aoe L incinerate Fluffy_Pillow 49071.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, soul_rot, redirected_anima(3)
3:10.364 aoe D rain_of_fire Fluffy_Pillow 48681.0/50000: 97% mana
3.0/5: 60% soul_shard
soul_rot, redirected_anima(11)
3:11.671 default A cataclysm Fluffy_Pillow 49334.5/50000: 99% mana
0.4/5: 8% soul_shard
soul_rot, redirected_anima(11)
3:13.412 aoe K conflagrate Fluffy_Pillow 49502.5/50000: 99% mana
1.1/5: 22% soul_shard
soul_rot, redirected_anima(11)
3:14.717 aoe L incinerate Fluffy_Pillow 49655.0/50000: 99% mana
1.8/5: 36% soul_shard
backdraft, soul_rot, redirected_anima(11)
3:15.936 default 9 soul_fire Fluffy_Pillow 49002.0/50000: 98% mana
2.4/5: 48% soul_shard
soul_rot, redirected_anima(11)
3:19.414 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
4.6/5: 92% soul_shard
redirected_anima(11)
3:22.355 aoe I havoc enemy2 49723.0/50000: 99% mana
5.0/5: 100% soul_shard
redirected_anima(10)
3:23.664 havoc Q chaos_bolt Fluffy_Pillow 49377.5/50000: 99% mana
5.0/5: 100% soul_shard
redirected_anima(10)
3:26.272 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima(9)
3:27.580 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft, redirected_anima(9)
3:29.407 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima(9)
3:30.713 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft, redirected_anima(9)
3:32.020 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.8/5: 96% soul_shard
backdraft, redirected_anima(9)
3:33.847 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima(9)
3:35.153 aoe G immolate enemy3 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
redirected_anima(9)
3:36.459 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
redirected_anima(9)
3:37.767 aoe L incinerate Fluffy_Pillow 49406.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft, redirected_anima(9)
3:38.985 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.7/5: 34% soul_shard
redirected_anima(8)
3:40.726 aoe L incinerate Fluffy_Pillow 48872.0/50000: 98% mana
2.2/5: 44% soul_shard
3:42.466 aoe F channel_demonfire Fluffy_Pillow 48742.0/50000: 97% mana
2.8/5: 56% soul_shard
redirected_anima
3:45.410 default A cataclysm Fluffy_Pillow 49464.0/50000: 99% mana
3.3/5: 66% soul_shard
redirected_anima
3:47.150 aoe J rain_of_fire Fluffy_Pillow 49502.0/50000: 99% mana
3.3/5: 66% soul_shard
redirected_anima
3:48.458 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
redirected_anima
3:49.764 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft, redirected_anima
3:50.984 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
redirected_anima
3:52.725 aoe I havoc enemy2 48873.0/50000: 98% mana
2.2/5: 44% soul_shard
redirected_anima
3:54.032 havoc N conflagrate Fluffy_Pillow 48526.5/50000: 97% mana
2.2/5: 44% soul_shard
redirected_anima
3:55.339 havoc Q chaos_bolt Fluffy_Pillow 48680.0/50000: 97% mana
3.5/5: 70% soul_shard
backdraft, redirected_anima
3:57.167 havoc P immolate Fluffy_Pillow 49594.0/50000: 99% mana
1.5/5: 30% soul_shard
redirected_anima
3:58.472 havoc R incinerate Fluffy_Pillow 49251.5/50000: 99% mana
1.8/5: 36% soul_shard
redirected_anima
4:00.211 havoc Q chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
2.3/5: 46% soul_shard
redirected_anima
4:02.820 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
redirected_anima
4:04.561 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
redirected_anima
4:05.868 default 9 soul_fire Fluffy_Pillow 49156.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, redirected_anima
4:09.346 aoe E soul_rot Fluffy_Pillow 49002.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft, redirected_anima
4:10.654 aoe F channel_demonfire Fluffy_Pillow 49406.5/50000: 99% mana
4.2/5: 84% soul_shard
backdraft, soul_rot, redirected_anima
4:13.468 aoe G immolate enemy3 50000.0/50000: 100% mana
4.7/5: 94% soul_shard
backdraft, soul_rot, redirected_anima(9)
4:14.774 aoe G immolate enemy2 49252.0/50000: 99% mana
4.7/5: 94% soul_shard
soul_rot, redirected_anima(9)
4:16.079 aoe J rain_of_fire Fluffy_Pillow 49154.5/50000: 98% mana
4.8/5: 96% soul_shard
soul_rot, redirected_anima(9)
4:17.386 default A cataclysm Fluffy_Pillow 49808.0/50000: 100% mana
1.9/5: 38% soul_shard
soul_rot, redirected_anima(9)
4:19.125 aoe K conflagrate Fluffy_Pillow 49501.5/50000: 99% mana
2.2/5: 44% soul_shard
redirected_anima(10)
4:20.433 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, redirected_anima(10)
4:21.654 aoe J rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.2/5: 64% soul_shard
redirected_anima(10)
4:22.960 aoe I havoc enemy2 49656.0/50000: 99% mana
0.3/5: 6% soul_shard
redirected_anima(10)
4:24.267 havoc R incinerate Fluffy_Pillow 49309.5/50000: 99% mana
0.5/5: 10% soul_shard
redirected_anima(10)
4:26.008 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
redirected_anima(10)
4:27.314 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft, redirected_anima(10)
4:29.142 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
redirected_anima(10)
4:30.883 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
redirected_anima(10)
4:32.189 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, redirected_anima(10)
4:33.495 havoc R incinerate Fluffy_Pillow 49058.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, redirected_anima(10)
4:34.716 aoe F channel_demonfire Fluffy_Pillow 48669.0/50000: 97% mana
3.2/5: 64% soul_shard
redirected_anima(10)
4:37.595 aoe G immolate enemy3 49358.5/50000: 99% mana
3.7/5: 74% soul_shard
redirected_anima(10)
4:38.903 aoe J rain_of_fire Fluffy_Pillow 49253.0/50000: 99% mana
3.8/5: 76% soul_shard
redirected_anima(10)
4:40.209 aoe K conflagrate Fluffy_Pillow 49906.0/50000: 100% mana
1.0/5: 20% soul_shard
redirected_anima(10)
4:41.516 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
backdraft, redirected_anima(2)
4:42.734 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
2.0/5: 40% soul_shard
redirected_anima(2)
4:44.475 aoe K conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.3/5: 46% soul_shard
redirected_anima
4:46.015 aoe J rain_of_fire Fluffy_Pillow 49142.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, redirected_anima(2)
4:47.320 aoe L incinerate Fluffy_Pillow 49794.5/50000: 100% mana
0.3/5: 6% soul_shard
backdraft, redirected_anima(2)
4:48.540 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.6/5: 12% soul_shard
redirected_anima(2)
4:50.280 default A cataclysm Fluffy_Pillow 48872.5/50000: 98% mana
1.1/5: 22% soul_shard
redirected_anima
4:52.022 aoe L incinerate Fluffy_Pillow 49243.5/50000: 98% mana
1.2/5: 24% soul_shard
redirected_anima
4:53.763 aoe I havoc enemy2 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
redirected_anima
4:55.070 havoc N conflagrate Fluffy_Pillow 48656.0/50000: 97% mana
1.8/5: 36% soul_shard
redirected_anima
4:56.377 havoc O soul_fire Fluffy_Pillow 48809.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, redirected_anima
4:59.854 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, redirected_anima
5:01.681 havoc Q chaos_bolt Fluffy_Pillow 49915.5/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima
5:04.291 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
redirected_anima
5:05.598 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
backdraft, redirected_anima
5:08.485 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft, redirected_anima
5:09.703 aoe J rain_of_fire Fluffy_Pillow 49001.5/50000: 98% mana
3.3/5: 66% soul_shard
redirected_anima(2)
5:11.009 aoe E soul_rot Fluffy_Pillow 49654.5/50000: 99% mana
0.5/5: 10% soul_shard
redirected_anima(2)
5:12.316 aoe G immolate enemy3 49752.5/50000: 100% mana
0.7/5: 14% soul_shard
soul_rot, redirected_anima(2)
5:13.624 aoe G immolate Fluffy_Pillow 49253.0/50000: 99% mana
0.9/5: 18% soul_shard
soul_rot, redirected_anima(10)
5:14.929 aoe G immolate enemy2 49155.5/50000: 98% mana
1.2/5: 24% soul_shard
soul_rot, redirected_anima(9)
5:16.236 aoe K conflagrate Fluffy_Pillow 49059.0/50000: 98% mana
1.2/5: 24% soul_shard
soul_rot, redirected_anima(9)
5:17.541 aoe L incinerate Fluffy_Pillow 49211.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft, soul_rot, redirected_anima(10)
5:18.762 aoe L incinerate Fluffy_Pillow 48822.0/50000: 98% mana
2.1/5: 42% soul_shard
soul_rot, redirected_anima(10)
5:20.503 aoe K conflagrate Fluffy_Pillow 48692.5/50000: 97% mana
2.6/5: 52% soul_shard
redirected_anima(10)

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Niya"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=320660/322721/infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Niya_burs : 9969 dps, 5347 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9969.0 9969.0 16.8 / 0.168% 812.5 / 8.1% 22.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.6 385.9 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
NightFae_Niya_burs 9969
Cataclysm 798 8.0% 9.7 32.36sec 24685 14526 Direct 29.2 6889 13776 8230 19.5% 0.0%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.73 29.20 0.00 0.00 1.6994 0.0000 240233.19 240233.19 0.00% 14526.13 14526.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.54% 23.52 14 33 6888.62 6142 8099 6887.87 6625 7137 161991 161991 0.00%
crit 19.46% 5.68 0 13 13775.71 12283 15991 13739.26 0 15006 78242 78242 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.80
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1068) 0.0% (10.7%) 12.1 25.79sec 26534 9849

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.10 0.00 180.93 0.00 2.6941 0.1634 0.00 0.00 0.00% 9848.95 9848.95

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:12.10
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1068 10.7% 0.0 0.00sec 0 0 Direct 542.8 496 994 592 19.2% 0.0%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 542.78 0.00 0.00 0.0000 0.0000 321154.58 321154.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 438.42 315 569 496.02 263 1101 496.36 466 524 217485 217485 0.00%
crit 19.23% 104.36 66 161 993.99 525 2197 994.16 844 1137 103670 103670 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1360 (1829) 13.6% (18.3%) 21.7 13.40sec 25296 12885 Direct 43.2 (86.1) 0 9452 9452 100.0% (60.0%) 0.0%

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.70 43.22 0.00 0.00 1.9633 0.0000 408388.57 408388.57 0.00% 12884.73 12884.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.22 32 58 9451.55 5908 13694 9449.87 9171 9720 408389 408389 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.81
  • if_expr:cast_time<havoc_remains
    Internal Combustion 469 4.7% 42.9 13.40sec 3281 0 Direct 42.9 2744 5488 3281 19.6% 0.0%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.86 42.86 0.00 0.00 0.0000 0.0000 140629.61 140629.61 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.42% 34.47 20 47 2744.22 1 4119 2746.81 2471 2952 94620 94620 0.00%
crit 19.58% 8.39 2 18 5487.64 2 8153 5494.33 3896 6834 46010 46010 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 842 8.5% 37.1 7.95sec 6834 5462 Direct 56.8 3742 7480 4461 19.2% 0.0%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.07 56.80 0.00 0.00 1.2512 0.0000 253321.11 253321.11 0.00% 5461.51 5461.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 45.88 32 60 3742.24 2047 5632 3742.11 3507 3995 171669 171669 0.00%
crit 19.22% 10.92 4 19 7480.50 4099 11132 7490.68 5974 9373 81652 81652 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.35
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.70
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1673 16.8% 26.7 10.73sec 18851 14942 Direct 34.0 1596 3195 1903 19.2% 0.0%
Periodic 348.5 1056 2113 1259 19.2% 0.0% 95.9%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.71 34.03 348.54 348.54 1.2616 2.4838 503561.49 503561.49 0.00% 559.90 14942.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 27.50 17 40 1595.75 820 2269 1595.38 1451 1749 43871 43871 0.00%
crit 19.21% 6.54 1 15 3195.47 1644 4458 3190.66 2182 4293 20878 20878 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.78% 281.56 215 354 1056.06 0 1441 1056.15 1030 1079 297348 297348 0.00%
crit 19.22% 66.97 40 98 2112.71 7 2833 2112.12 1997 2219 141465 141465 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:18.01
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.81
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 638 6.4% 44.9 6.15sec 4288 2928 Direct 55.5 (55.5) 2899 5809 3466 19.5% (19.5%) 0.0%

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.88 55.52 0.00 0.00 1.4643 0.0000 192415.25 192415.25 0.00% 2928.25 2928.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.50% 44.69 27 64 2898.65 1324 3862 2900.18 2718 3145 129529 129529 0.00%
crit 19.50% 10.82 2 21 5808.84 2785 7731 5815.67 4485 6767 62886 62886 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:34.09
    havoc
    [R]:11.02
  • if_expr:cast_time<havoc_remains
Rain of Fire 950 9.5% 17.5 16.37sec 16268 13047 Periodic 415.7 576 1152 687 19.2% 0.0% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.55 0.00 0.00 415.74 1.2469 0.0000 285436.06 285436.06 0.00% 13046.72 13046.72
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.81% 335.97 227 461 576.02 507 675 576.02 566 587 193530 193530 0.00%
crit 19.19% 79.77 43 121 1152.19 1013 1350 1152.02 1118 1180 91906 91906 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.33
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.21
Soul Fire 523 5.3% 5.6 49.36sec 28222 8116 Direct 7.8 16838 33868 20066 18.9% 0.0%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.57 7.84 0.00 0.00 3.4775 0.0000 157225.27 157225.27 0.00% 8115.69 8115.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.14% 6.36 2 10 16837.51 8618 23472 16916.37 14179 21318 107217 107217 0.00%
crit 18.86% 1.48 0 5 33868.19 17290 46492 27163.17 0 46117 50008 50008 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.34
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.34
  • if_expr:cast_time<havoc_remains
Soul Rot 340 3.4% 5.3 62.53sec 19307 15447 Periodic 97.1 883 1764 1053 19.3% 0.0% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.30 0.00 97.14 97.14 1.2499 1.2900 102292.63 102292.63 0.00% 775.32 15447.39
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.71% 78.41 50 102 883.05 424 1395 883.32 820 942 69243 69243 0.00%
crit 19.29% 18.74 8 32 1764.45 849 2790 1760.52 1340 2258 33050 33050 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.32
Summon Infernal 81 0.8% 2.0 180.58sec 12084 10454 Direct 6.0 3348 6696 4026 20.3% 0.0%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24168.52 24168.52 0.00% 10453.51 10453.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.69% 4.78 1 6 3348.13 3348 3348 3348.13 3348 3348 16009 16009 0.00%
crit 20.31% 1.22 0 5 6696.27 6696 6696 4848.65 0 6696 8159 8159 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3518 / 711
Immolation 3252 6.5% 39.0 5.49sec 5004 0 Direct 117.0 1395 2790 1668 19.6% 0.0%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 195147.68 195147.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.44% 94.11 79 107 1395.06 1395 1395 1395.06 1395 1395 131295 131295 0.00%
crit 19.56% 22.89 10 38 2790.11 2790 2790 2790.11 2790 2790 63852 63852 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15919.87 22739.94 29.99% 270.27 270.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 33.10 25 39 325.55 326 326 325.55 326 326 10775 15392 29.99%
crit 19.27% 7.90 2 16 651.10 651 651 651.10 651 651 5144 7348 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 515 / 515
Firebolt 515 5.2% 93.6 3.21sec 1654 1136 Direct 92.9 1395 2790 1667 19.4% 0.0%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.58 92.89 0.00 0.00 1.4562 0.0000 154788.94 154788.94 0.00% 1135.86 1135.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.56% 74.83 53 96 1395.06 1395 1395 1395.06 1395 1395 104393 104393 0.00%
crit 19.44% 18.06 6 31 2790.11 2790 2790 2790.11 2790 2790 50396 50396 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:94.02
Simple Action Stats Execute Interval
NightFae_Niya_burs
Havoc 9.7 32.03sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.68 0.00 0.00 0.00 1.2446 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.68
  • if_expr:!(target=self.target)&active_enemies<4
Spiked Burrs 9.5 27.65sec

Stats Details: Spiked Burrs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.49 9.49 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
miss 100.00% 9.49 3 18 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Spiked Burrs

  • id:333526
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.360000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:333526
  • name:Spiked Burrs
  • school:nature
  • tooltip:Movement speed reduced by $w1%. Suffering $w2 Nature damage every $t2 sec.
  • description:{$@spelldesc320659=Your damaging attacks and spells have a chance to toss Niya's Spiked Burrs under your target. The burrs latch onto the first enemy to cross them, reducing movement speed by {$333526s1=20}% and inflicting ${$<points>*{$333526d=6 seconds}} Nature damage over {$333526d=6 seconds}.}
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.1 0.0 8.0sec 8.0sec 4.1sec 50.60% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:NightFae_Niya_burs
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.1s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.60%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Niya_burs
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Redirected Anima 16.3 0.0 47.9sec 18.4sec 59.4sec 84.52% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:NightFae_Niya_burs
  • cooldown name:buff_redirected_anima
  • max_stacks:50
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:25.00

Trigger Details

  • interval_min/max:0.0s / 264.1s
  • trigger_min/max:0.0s / 64.6s
  • trigger_pct:99.00%
  • duration_min/max:0.3s / 283.7s

Stack Uptimes

  • redirected_anima_1:20.04%
  • redirected_anima_2:10.03%
  • redirected_anima_3:3.31%
  • redirected_anima_4:0.82%
  • redirected_anima_5:0.15%
  • redirected_anima_6:0.00%
  • redirected_anima_8:16.66%
  • redirected_anima_9:20.00%
  • redirected_anima_10:9.57%
  • redirected_anima_11:3.02%
  • redirected_anima_12:0.84%
  • redirected_anima_13:0.18%
  • redirected_anima_14:0.07%
  • redirected_anima_15:0.13%

Spelldata

  • id:342814
  • name:Redirected Anima
  • tooltip:Max health increased by $w1%. Mastery increased by $w2.
  • description:{$@spelldesc322721=Healing or dealing damage has a chance to grant you a stack of Redirected Anima. Redirected Anima increases your maximum health by {$342814s1=1}% and your Mastery by {$342814s2=25} for {$342814d=30 seconds}, and stacks overlap. $?(s152280&a137005)[Defile]?(a137005&!s152280)[Death's Due]?a212611[The Hunt]?a137009[Convoke the Spirits]?a137014[Wild Spirits]?a137018[Shifting Power]?a137022[Faeline Stomp]?a137026[Blessing of Seasons]?a137030[Fae Guardians]?a137034[Sepsis]?a137038[Fae Transfusion]?a137042[Soul Rot]?a137047[Ancient Aftershock][Activating your Night Fae class ability] grants you ${{$s3=8}*$<mod>} stacks of Redirected Anima.}
  • max_stacks:50
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Soul Rot 5.3 0.0 62.5sec 62.5sec 7.9sec 13.92% 0.00% 0.0 (0.0) 5.2

Buff Details

  • buff initial source:NightFae_Niya_burs
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 69.0s
  • trigger_min/max:61.3s / 69.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • soul_rot_1:13.92%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya_burs_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.5s
  • trigger_min/max:180.0s / 185.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya_burs_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.5s
  • trigger_min/max:180.0s / 185.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.22% 10.91% 17.41% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Niya_burs
soul_fire Soul Shard 6.58 7.18 7.53% 1.09 0.73 9.20%
immolate Soul Shard 348.50 33.71 35.38% 0.10 1.14 3.28%
incinerate Soul Shard 44.88 11.16 11.72% 0.25 0.01 0.05%
conflagrate Soul Shard 37.05 28.38 29.79% 0.77 0.00 0.00%
mana_regen Mana 661.52 116167.19 100.00% 175.61 34014.56 22.65%
immolate_crits Soul Shard 33.11 3.20 3.36% 0.10 0.11 3.25%
incinerate_crits Soul Shard 10.82 1.08 1.13% 0.10 0.00 0.06%
infernal Soul Shard 120.00 10.55 11.08% 0.09 1.45 12.08%
pet - imp
energy_regen Energy 362.19 3571.98 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 385.92 388.61 34034.1 49190.6 47908.5 50000.0
Soul Shard 4.0 0.32 0.32 3.4 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Niya_burs
cataclysm Mana 9.7 4869.4 500.0 500.3 49.3
channel_demonfire Mana 12.1 9074.7 750.0 749.7 35.4
chaos_bolt Soul Shard 21.7 43.4 2.0 2.0 12654.8
conflagrate Mana 37.1 18527.2 500.0 499.8 13.7
havoc Mana 9.7 9682.7 1000.0 1000.0 0.0
immolate Mana 26.7 20042.4 750.0 750.3 25.1
incinerate Mana 44.9 44877.1 1000.0 1000.0 4.3
rain_of_fire Soul Shard 17.5 52.6 3.0 3.0 5425.5
soul_fire Mana 6.6 6580.1 1000.0 1181.1 23.9
soul_rot Mana 5.3 1322.7 250.0 249.6 77.3
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 93.6 3742.8 40.0 40.0 41.4

Statistics & Data Analysis

Fight Length
NightFae_Niya_burs Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
NightFae_Niya_burs Damage Per Second
Count 627
Mean 9968.96
Minimum 9434.71
Maximum 10580.30
Spread ( max - min ) 1145.58
Range [ ( max - min ) / 2 * 100% ] 5.75%
Standard Deviation 214.3295
5th Percentile 9630.23
95th Percentile 10332.86
( 95th Percentile - 5th Percentile ) 702.63
Mean Distribution
Standard Deviation 8.5595
95.00% Confidence Interval ( 9952.19 - 9985.74 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1776
0.1 Scale Factor Error with Delta=300 393
0.05 Scale Factor Error with Delta=300 1569
0.01 Scale Factor Error with Delta=300 39215
Priority Target DPS
NightFae_Niya_burs Priority Target Damage Per Second
Count 627
Mean 5347.19
Minimum 5050.51
Maximum 5688.59
Spread ( max - min ) 638.07
Range [ ( max - min ) / 2 * 100% ] 5.97%
Standard Deviation 125.0904
5th Percentile 5150.60
95th Percentile 5560.77
( 95th Percentile - 5th Percentile ) 410.17
Mean Distribution
Standard Deviation 4.9956
95.00% Confidence Interval ( 5337.40 - 5356.99 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2103
0.1 Scale Factor Error with Delta=300 134
0.05 Scale Factor Error with Delta=300 535
0.01 Scale Factor Error with Delta=300 13358
DPS(e)
NightFae_Niya_burs Damage Per Second (Effective)
Count 627
Mean 9968.96
Minimum 9434.71
Maximum 10580.30
Spread ( max - min ) 1145.58
Range [ ( max - min ) / 2 * 100% ] 5.75%
Damage
NightFae_Niya_burs Damage
Count 627
Mean 2628826.28
Minimum 2072554.66
Maximum 3212617.56
Spread ( max - min ) 1140062.90
Range [ ( max - min ) / 2 * 100% ] 21.68%
DTPS
NightFae_Niya_burs Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Niya_burs Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Niya_burs Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Niya_burs Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Niya_burs Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Niya_burs Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_Niya_bursTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Niya_burs Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.34 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.80 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.33 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.32 soul_rot
F 12.10 channel_demonfire,if=dot.immolate.remains>cast_time
G 18.01 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.68 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.21 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.35 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 34.09 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.70 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.34 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.81 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.81 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.02 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGGDLKLLDKALLKFIQQPONJLGKLJFKLAELLINQQPRNFGJLKLLL9AJINQRNQPFKLLGJGKLLELAINQQPRN9FJGKLGJKLLLAINQRQRNPFGJGLMKELD9AINQNQQNPDFGLGKJLLLKLAIQNQPRR9FJGEGKLKJLKAIQRRNQPFKLLJGLKLGG9AFIQNQNPQLEKGJGFG

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E soul_rot Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.746 aoe F channel_demonfire Fluffy_Pillow 49623.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:05.056 cds M summon_infernal Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot, redirected_anima(8)
0:06.063 aoe I havoc enemy2 49503.5/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot, redirected_anima(9)
0:07.069 havoc Q chaos_bolt Fluffy_Pillow 49006.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot, redirected_anima(9)
0:09.077 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot, redirected_anima(9)
0:10.082 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot, redirected_anima(9)
0:11.489 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, redirected_anima(9)
0:12.495 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:13.503 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:14.910 havoc N conflagrate Fluffy_Pillow 49956.5/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust, redirected_anima(9)
0:15.916 havoc Q chaos_bolt Fluffy_Pillow 49959.5/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:17.323 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, redirected_anima(9)
0:18.331 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:19.338 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:21.625 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:22.632 aoe G immolate enemy2 49252.5/50000: 99% mana
2.7/5: 54% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:23.637 aoe G immolate enemy3 49005.0/50000: 98% mana
2.9/5: 58% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:24.643 aoe D rain_of_fire Fluffy_Pillow 48758.0/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:25.650 aoe L incinerate Fluffy_Pillow 49261.5/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:26.590 aoe K conflagrate Fluffy_Pillow 48731.5/50000: 97% mana
1.0/5: 20% soul_shard
bloodlust, redirected_anima(9)
0:27.596 aoe L incinerate Fluffy_Pillow 48734.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft, redirected_anima(9)
0:28.534 aoe L incinerate Fluffy_Pillow 48203.5/50000: 96% mana
2.3/5: 46% soul_shard
bloodlust, redirected_anima(10)
0:29.876 aoe D rain_of_fire Fluffy_Pillow 47874.5/50000: 96% mana
3.1/5: 62% soul_shard
bloodlust, redirected_anima(10)
0:30.882 aoe K conflagrate Fluffy_Pillow 48377.5/50000: 97% mana
0.4/5: 8% soul_shard
bloodlust, redirected_anima(10)
0:31.888 default A cataclysm Fluffy_Pillow 48380.5/50000: 97% mana
1.4/5: 28% soul_shard
bloodlust, backdraft, redirected_anima(10)
0:33.229 aoe L incinerate Fluffy_Pillow 48551.0/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft, redirected_anima(2)
0:34.169 aoe L incinerate Fluffy_Pillow 48021.0/50000: 96% mana
2.4/5: 48% soul_shard
bloodlust, redirected_anima(2)
0:35.510 aoe K conflagrate Fluffy_Pillow 47691.5/50000: 95% mana
2.9/5: 58% soul_shard
bloodlust, redirected_anima
0:36.696 aoe F channel_demonfire Fluffy_Pillow 47784.5/50000: 96% mana
3.7/5: 74% soul_shard
bloodlust, backdraft, redirected_anima
0:38.869 aoe I havoc enemy2 48121.0/50000: 96% mana
4.0/5: 80% soul_shard
bloodlust, backdraft, redirected_anima
0:39.876 havoc Q chaos_bolt Fluffy_Pillow 47624.5/50000: 95% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, redirected_anima
0:41.284 havoc Q chaos_bolt Fluffy_Pillow 48328.5/50000: 97% mana
2.3/5: 46% soul_shard
redirected_anima
0:43.893 havoc P immolate Fluffy_Pillow 49633.0/50000: 99% mana
0.6/5: 12% soul_shard
redirected_anima
0:45.200 havoc O soul_fire Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
redirected_anima
0:48.679 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
3.2/5: 64% soul_shard
redirected_anima
0:49.983 aoe J rain_of_fire Fluffy_Pillow 49155.0/50000: 98% mana
4.4/5: 88% soul_shard
backdraft, redirected_anima
0:51.290 aoe L incinerate Fluffy_Pillow 49808.5/50000: 100% mana
1.6/5: 32% soul_shard
backdraft, redirected_anima
0:52.510 aoe G immolate enemy3 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
redirected_anima
0:53.816 aoe K conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
2.1/5: 42% soul_shard
redirected_anima
0:55.123 aoe L incinerate Fluffy_Pillow 49059.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, redirected_anima
0:56.344 aoe J rain_of_fire Fluffy_Pillow 48669.5/50000: 97% mana
3.2/5: 64% soul_shard
redirected_anima
0:57.651 aoe F channel_demonfire Fluffy_Pillow 49323.0/50000: 99% mana
0.4/5: 8% soul_shard
redirected_anima
1:00.556 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
1:01.863 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
backdraft
1:03.084 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
1.7/5: 34% soul_shard
1:04.965 aoe E soul_rot Fluffy_Pillow 49443.5/50000: 99% mana
1.8/5: 36% soul_shard
1:06.271 aoe L incinerate Fluffy_Pillow 49752.0/50000: 100% mana
2.1/5: 42% soul_shard
soul_rot
1:08.010 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
2.5/5: 50% soul_shard
soul_rot, redirected_anima(8)
1:09.749 aoe I havoc enemy2 48871.0/50000: 98% mana
2.8/5: 56% soul_shard
soul_rot, redirected_anima(8)
1:11.055 havoc N conflagrate Fluffy_Pillow 48524.0/50000: 97% mana
3.0/5: 60% soul_shard
soul_rot, redirected_anima(9)
1:12.361 havoc Q chaos_bolt Fluffy_Pillow 48677.0/50000: 97% mana
4.2/5: 84% soul_shard
backdraft, soul_rot, redirected_anima(9)
1:14.191 havoc Q chaos_bolt Fluffy_Pillow 49592.0/50000: 99% mana
2.5/5: 50% soul_shard
soul_rot, redirected_anima(9)
1:16.800 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
redirected_anima(10)
1:18.106 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.8/5: 16% soul_shard
redirected_anima(10)
1:19.846 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
redirected_anima(10)
1:21.154 aoe F channel_demonfire Fluffy_Pillow 49156.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, redirected_anima(10)
1:24.044 aoe G immolate enemy3 49851.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft, redirected_anima(10)
1:25.351 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft, redirected_anima(10)
1:26.656 aoe L incinerate Fluffy_Pillow 49905.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft, redirected_anima(10)
1:27.876 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
redirected_anima(10)
1:29.183 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft, redirected_anima(10)
1:30.401 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
1.8/5: 36% soul_shard
redirected_anima(10)
1:32.142 aoe L incinerate Fluffy_Pillow 48635.5/50000: 97% mana
2.2/5: 44% soul_shard
redirected_anima(10)
1:33.882 default 9 soul_fire Fluffy_Pillow 48505.5/50000: 97% mana
2.8/5: 56% soul_shard
redirected_anima(10)
1:37.359 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
4.2/5: 84% soul_shard
redirected_anima(2)
1:39.101 aoe J rain_of_fire Fluffy_Pillow 49373.0/50000: 99% mana
4.3/5: 86% soul_shard
redirected_anima(2)
1:40.409 aoe I havoc enemy2 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
redirected_anima
1:41.715 havoc N conflagrate Fluffy_Pillow 49653.0/50000: 99% mana
1.7/5: 34% soul_shard
redirected_anima
1:43.022 havoc Q chaos_bolt Fluffy_Pillow 49806.5/50000: 100% mana
2.8/5: 56% soul_shard
backdraft, redirected_anima
1:44.850 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
redirected_anima
1:46.590 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
1:47.895 havoc Q chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
1:49.724 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
1:51.030 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
1:53.854 aoe K conflagrate Fluffy_Pillow 49914.0/50000: 100% mana
1.6/5: 32% soul_shard
1:55.163 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
1:56.382 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
1:58.121 aoe G immolate enemy3 48871.5/50000: 98% mana
3.0/5: 60% soul_shard
1:59.428 aoe J rain_of_fire Fluffy_Pillow 48775.0/50000: 98% mana
3.1/5: 62% soul_shard
2:00.734 aoe G immolate enemy2 49428.0/50000: 99% mana
0.3/5: 6% soul_shard
2:02.041 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
0.4/5: 8% soul_shard
2:03.348 aoe L incinerate Fluffy_Pillow 49406.0/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
2:04.568 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
2:06.308 aoe E soul_rot Fluffy_Pillow 48872.5/50000: 98% mana
2.0/5: 40% soul_shard
2:07.613 aoe L incinerate Fluffy_Pillow 49275.0/50000: 99% mana
2.0/5: 40% soul_shard
soul_rot
2:09.354 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.5/5: 50% soul_shard
soul_rot, redirected_anima(8)
2:11.095 aoe I havoc enemy2 49373.0/50000: 99% mana
2.7/5: 54% soul_shard
soul_rot, redirected_anima(8)
2:12.401 havoc N conflagrate Fluffy_Pillow 49026.0/50000: 98% mana
2.8/5: 56% soul_shard
soul_rot, redirected_anima(8)
2:13.709 havoc Q chaos_bolt Fluffy_Pillow 49180.0/50000: 98% mana
4.0/5: 80% soul_shard
backdraft, soul_rot, redirected_anima(8)
2:15.535 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.1/5: 42% soul_shard
soul_rot, redirected_anima(8)
2:18.144 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
redirected_anima(8)
2:19.449 havoc R incinerate Fluffy_Pillow 49251.5/50000: 99% mana
0.7/5: 14% soul_shard
redirected_anima(8)
2:21.189 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
redirected_anima(8)
2:22.496 default 9 soul_fire Fluffy_Pillow 49155.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, redirected_anima(8)
2:25.974 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.8/5: 76% soul_shard
backdraft, redirected_anima(8)
2:28.798 aoe J rain_of_fire Fluffy_Pillow 49664.5/50000: 99% mana
4.2/5: 84% soul_shard
backdraft, redirected_anima(8)
2:30.104 aoe G immolate enemy3 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
backdraft, redirected_anima(8)
2:31.409 aoe K conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
1.7/5: 34% soul_shard
redirected_anima(8)
2:32.716 aoe L incinerate Fluffy_Pillow 49405.0/50000: 99% mana
2.5/5: 50% soul_shard
backdraft, redirected_anima(8)
2:33.936 aoe G immolate enemy2 49002.5/50000: 98% mana
2.8/5: 56% soul_shard
redirected_anima(9)
2:35.241 aoe J rain_of_fire Fluffy_Pillow 48905.0/50000: 98% mana
3.0/5: 60% soul_shard
redirected_anima(9)
2:36.546 aoe K conflagrate Fluffy_Pillow 49557.5/50000: 99% mana
0.1/5: 2% soul_shard
redirected_anima(9)
2:37.852 aoe L incinerate Fluffy_Pillow 49710.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft, redirected_anima
2:39.073 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.1/5: 22% soul_shard
redirected_anima
2:40.813 aoe L incinerate Fluffy_Pillow 48873.0/50000: 98% mana
1.6/5: 32% soul_shard
redirected_anima
2:42.553 default A cataclysm Fluffy_Pillow 48743.0/50000: 97% mana
2.1/5: 42% soul_shard
redirected_anima
2:44.294 aoe I havoc enemy2 49113.5/50000: 98% mana
2.3/5: 46% soul_shard
redirected_anima
2:45.601 havoc N conflagrate Fluffy_Pillow 48767.0/50000: 98% mana
2.5/5: 50% soul_shard
redirected_anima
2:46.906 havoc Q chaos_bolt Fluffy_Pillow 48919.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft, redirected_anima
2:48.734 havoc R incinerate Fluffy_Pillow 49833.5/50000: 100% mana
1.8/5: 36% soul_shard
redirected_anima
2:50.475 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.6/5: 52% soul_shard
redirected_anima
2:53.085 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
redirected_anima
2:54.824 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.4/5: 28% soul_shard
redirected_anima
2:56.132 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, redirected_anima
2:57.439 aoe F channel_demonfire Fluffy_Pillow 49059.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, redirected_anima
3:00.325 aoe G immolate enemy2 49752.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft, redirected_anima
3:01.632 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft, redirected_anima
3:02.939 aoe G immolate enemy3 49906.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft, redirected_anima
3:04.245 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.5/5: 10% soul_shard
backdraft
3:05.465 cds M summon_infernal Fluffy_Pillow 48862.0/50000: 98% mana
0.7/5: 14% soul_shard
3:06.771 aoe K conflagrate Fluffy_Pillow 48515.0/50000: 97% mana
1.1/5: 22% soul_shard
3:08.077 aoe E soul_rot Fluffy_Pillow 48668.0/50000: 97% mana
2.0/5: 40% soul_shard
backdraft
3:09.383 aoe L incinerate Fluffy_Pillow 49071.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, soul_rot
3:10.602 aoe D rain_of_fire Fluffy_Pillow 48680.5/50000: 97% mana
3.0/5: 60% soul_shard
soul_rot, redirected_anima(9)
3:11.908 default 9 soul_fire Fluffy_Pillow 49333.5/50000: 99% mana
0.4/5: 8% soul_shard
soul_rot, redirected_anima(9)
3:15.385 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
soul_rot, redirected_anima(9)
3:17.127 aoe I havoc enemy2 49373.0/50000: 99% mana
3.2/5: 64% soul_shard
soul_rot, redirected_anima(9)
3:18.434 havoc N conflagrate Fluffy_Pillow 49026.5/50000: 98% mana
3.5/5: 70% soul_shard
redirected_anima(9)
3:19.740 havoc Q chaos_bolt Fluffy_Pillow 49179.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, redirected_anima(9)
3:21.567 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima(9)
3:22.874 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft, redirected_anima(9)
3:24.700 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima(9)
3:27.311 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
redirected_anima(9)
3:28.618 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft, redirected_anima(9)
3:29.925 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft, redirected_anima(9)
3:31.232 aoe F channel_demonfire Fluffy_Pillow 49906.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft, redirected_anima(9)
3:34.074 aoe G immolate enemy2 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft, redirected_anima(9)
3:35.380 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, redirected_anima(9)
3:36.601 aoe G immolate enemy3 48862.5/50000: 98% mana
2.4/5: 48% soul_shard
redirected_anima(9)
3:37.909 aoe K conflagrate Fluffy_Pillow 48766.5/50000: 98% mana
2.6/5: 52% soul_shard
redirected_anima(9)
3:39.214 aoe J rain_of_fire Fluffy_Pillow 48919.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, redirected_anima(9)
3:40.521 aoe L incinerate Fluffy_Pillow 49572.5/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
3:41.740 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
3:43.480 aoe L incinerate Fluffy_Pillow 48872.0/50000: 98% mana
1.4/5: 28% soul_shard
3:45.220 aoe K conflagrate Fluffy_Pillow 48742.0/50000: 97% mana
1.7/5: 34% soul_shard
3:46.528 aoe L incinerate Fluffy_Pillow 48896.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
3:47.749 default A cataclysm Fluffy_Pillow 48506.5/50000: 97% mana
2.7/5: 54% soul_shard
3:49.489 aoe I havoc enemy2 48876.5/50000: 98% mana
2.9/5: 58% soul_shard
3:50.796 havoc Q chaos_bolt Fluffy_Pillow 48530.0/50000: 97% mana
3.1/5: 62% soul_shard
3:53.404 havoc N conflagrate Fluffy_Pillow 49834.0/50000: 100% mana
1.4/5: 28% soul_shard
3:54.711 havoc Q chaos_bolt Fluffy_Pillow 49987.5/50000: 100% mana
2.6/5: 52% soul_shard
backdraft
3:56.537 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
3:57.844 havoc R incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
3:59.585 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
4:01.327 default 9 soul_fire Fluffy_Pillow 48873.5/50000: 98% mana
2.2/5: 44% soul_shard
4:04.805 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.7/5: 74% soul_shard
4:07.569 aoe J rain_of_fire Fluffy_Pillow 49634.5/50000: 99% mana
4.1/5: 82% soul_shard
redirected_anima
4:08.875 aoe G immolate enemy3 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
redirected_anima
4:10.181 aoe E soul_rot Fluffy_Pillow 49252.0/50000: 99% mana
1.4/5: 28% soul_shard
redirected_anima
4:11.486 aoe G immolate enemy2 49654.5/50000: 99% mana
1.7/5: 34% soul_shard
soul_rot, redirected_anima
4:12.791 aoe K conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
1.9/5: 38% soul_shard
soul_rot, redirected_anima(9)
4:14.099 aoe L incinerate Fluffy_Pillow 49405.5/50000: 99% mana
2.6/5: 52% soul_shard
backdraft, soul_rot, redirected_anima(9)
4:15.319 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.9/5: 58% soul_shard
soul_rot, redirected_anima(9)
4:16.627 aoe J rain_of_fire Fluffy_Pillow 49156.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft, soul_rot, redirected_anima(10)
4:17.932 aoe L incinerate Fluffy_Pillow 49809.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, soul_rot, redirected_anima(10)
4:19.152 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
soul_rot, redirected_anima(10)
4:20.458 default A cataclysm Fluffy_Pillow 49155.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft, redirected_anima(10)
4:22.199 aoe I havoc enemy2 49502.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft, redirected_anima(10)
4:23.505 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft, redirected_anima(10)
4:25.333 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
redirected_anima(10)
4:27.074 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
redirected_anima(10)
4:28.816 havoc N conflagrate Fluffy_Pillow 48873.5/50000: 98% mana
1.6/5: 32% soul_shard
redirected_anima(10)
4:30.123 havoc Q chaos_bolt Fluffy_Pillow 49027.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, redirected_anima(10)
4:31.949 havoc P immolate Fluffy_Pillow 49940.0/50000: 100% mana
1.1/5: 22% soul_shard
redirected_anima(10)
4:33.255 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.2/5: 24% soul_shard
redirected_anima(10)
4:36.117 aoe K conflagrate Fluffy_Pillow 49933.0/50000: 100% mana
1.5/5: 30% soul_shard
redirected_anima(9)
4:37.573 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft, redirected_anima(9)
4:38.793 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.6/5: 52% soul_shard
redirected_anima(9)
4:40.534 aoe J rain_of_fire Fluffy_Pillow 48873.0/50000: 98% mana
3.2/5: 64% soul_shard
redirected_anima(9)
4:41.841 aoe G immolate enemy3 49526.5/50000: 99% mana
0.3/5: 6% soul_shard
redirected_anima
4:43.149 aoe L incinerate Fluffy_Pillow 49253.0/50000: 99% mana
0.5/5: 10% soul_shard
redirected_anima
4:44.888 aoe K conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
0.8/5: 16% soul_shard
redirected_anima
4:46.225 aoe L incinerate Fluffy_Pillow 49170.0/50000: 98% mana
1.5/5: 30% soul_shard
backdraft, redirected_anima
4:47.444 aoe G immolate enemy2 48779.5/50000: 98% mana
1.8/5: 36% soul_shard
4:48.748 aoe G immolate Fluffy_Pillow 48681.5/50000: 97% mana
2.0/5: 40% soul_shard
4:50.054 default 9 soul_fire Fluffy_Pillow 48584.5/50000: 97% mana
2.2/5: 44% soul_shard
4:53.531 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
3.7/5: 74% soul_shard
4:55.271 aoe F channel_demonfire Fluffy_Pillow 49372.0/50000: 99% mana
3.8/5: 76% soul_shard
redirected_anima
4:58.001 aoe I havoc enemy2 49987.0/50000: 100% mana
4.3/5: 86% soul_shard
redirected_anima
4:59.308 havoc Q chaos_bolt Fluffy_Pillow 49640.5/50000: 99% mana
4.4/5: 88% soul_shard
redirected_anima
5:01.919 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
redirected_anima
5:03.226 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
backdraft, redirected_anima
5:05.056 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
redirected_anima
5:06.364 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft, redirected_anima
5:07.670 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft, redirected_anima
5:09.497 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
redirected_anima
5:11.235 aoe E soul_rot Fluffy_Pillow 49001.0/50000: 98% mana
2.2/5: 44% soul_shard
redirected_anima
5:12.789 aoe K conflagrate Fluffy_Pillow 49528.0/50000: 99% mana
2.3/5: 46% soul_shard
soul_rot, redirected_anima
5:14.095 aoe G immolate enemy3 49681.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft, soul_rot, redirected_anima(9)
5:15.402 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft, soul_rot, redirected_anima(9)
5:16.708 aoe G immolate Fluffy_Pillow 49905.5/50000: 100% mana
0.5/5: 10% soul_shard
backdraft, soul_rot, redirected_anima(9)
5:18.013 aoe F channel_demonfire Fluffy_Pillow 49251.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft, soul_rot, redirected_anima(9)
5:20.837 aoe G immolate enemy2 49913.5/50000: 100% mana
1.0/5: 20% soul_shard
backdraft, redirected_anima(11)

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Niya_burs"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=320659/322721/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_Draven_War : 9874 dps, 5278 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9874.2 9874.2 17.4 / 0.176% 847.5 / 8.6% 21.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
409.8 406.5 Mana 0.00% 38.1 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Draven_War 9874
Cataclysm 802 8.1% 9.7 32.40sec 24874 14639 Direct 29.1 6944 13894 8295 19.4%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.70 29.09 0.00 0.00 1.6993 0.0000 241205.17 241205.17 0.00% 14638.90 14638.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 23.45 13 34 6943.56 6142 7553 6944.18 6706 7182 162830 162830 0.00%
crit 19.39% 5.64 0 14 13894.32 12288 15105 13873.67 0 14889 78376 78376 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.76
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1067) 0.0% (10.8%) 12.3 25.49sec 26135 9696

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.27 0.00 183.27 0.00 2.6956 0.1636 0.00 0.00 0.00% 9695.70 9695.70

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.27
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1067 10.8% 0.0 0.00sec 0 0 Direct 549.8 488 977 583 19.4%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 549.81 0.00 0.00 0.0000 0.0000 320665.75 320665.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 443.07 312 575 488.40 263 1015 488.62 461 517 216396 216396 0.00%
crit 19.41% 106.74 70 148 976.99 525 2031 977.20 788 1110 104269 104269 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1417 (1904) 14.3% (19.3%) 22.8 12.78sec 25098 12746 Direct 45.3 (90.2) 0 9388 9388 100.0% (59.7%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.77 45.32 0.00 0.00 1.9691 0.0000 425442.69 425442.69 0.00% 12746.03 12746.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 45.32 30 58 9388.20 6097 12733 9387.39 9131 9610 425443 425443 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.86
  • if_expr:cast_time<havoc_remains
    Internal Combustion 487 4.9% 44.9 12.80sec 3250 0 Direct 44.9 2730 5473 3251 19.0%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.93 44.93 0.00 0.00 0.0000 0.0000 146038.21 146038.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.99% 36.39 19 50 2730.01 1 3864 2731.20 2528 2890 99327 99327 0.00%
crit 19.01% 8.54 2 18 5473.17 2 7725 5472.65 4119 6696 46711 46711 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 831 8.4% 37.2 7.95sec 6719 5375 Direct 56.0 3762 7504 4467 18.8%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.18 55.96 0.00 0.00 1.2500 0.0000 249793.75 249793.75 0.00% 5374.91 5374.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.21% 45.44 30 61 3761.51 2089 5245 3761.14 3507 4045 170895 170895 0.00%
crit 18.79% 10.51 3 24 7504.01 4177 10489 7511.53 5559 9322 78898 78898 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.43
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.72
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1670 16.9% 28.2 10.25sec 17826 14104 Direct 35.2 1600 3200 1907 19.2%
Periodic 347.1 1052 2104 1255 19.2% 95.4%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.19 35.22 347.09 347.09 1.2639 2.4818 502546.42 502546.42 0.00% 560.24 14104.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 28.46 18 42 1600.04 852 2098 1600.25 1481 1711 45540 45540 0.00%
crit 19.18% 6.75 1 16 3199.98 1707 4196 3196.90 2358 4059 21610 21610 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.79% 280.40 211 347 1052.24 0 1311 1052.24 1032 1071 295049 295049 0.00%
crit 19.21% 66.69 39 95 2104.44 1 2622 2104.45 1988 2218 140348 140348 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.99
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.31
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (237) 0.0% (2.4%) 4.7 64.64sec 15114 9131

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.70 0.00 0.00 0.00 1.6554 0.0000 0.00 0.00 0.00% 9131.08 9131.08

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.73
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 32 0.3% 0.0 0.00sec 0 0 Direct 14.0 580 1161 696 19.9%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.96 0.00 0.00 0.0000 0.0000 9713.32 9713.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.15% 11.19 5 17 580.47 580 580 580.47 580 580 6495 6495 0.00%
crit 19.85% 2.77 0 8 1160.93 1161 1161 1088.72 0 1161 3218 3218 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 204 2.1% 0.0 0.00sec 0 0 Periodic 102.1 503 1006 600 19.4% 18.2%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 102.08 102.08 0.0000 1.6138 61299.12 61299.12 0.00% 372.13 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.62% 82.30 61 105 503.03 463 508 503.04 501 506 41397 41397 0.00%
crit 19.38% 19.78 7 36 1006.21 927 1016 1006.15 988 1016 19902 19902 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 599 6.1% 41.9 6.59sec 4314 2948 Direct 52.6 (52.6) 2879 5769 3437 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.92 52.63 0.00 0.00 1.4634 0.0000 180836.65 180836.65 0.00% 2947.81 2947.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 42.50 24 63 2879.45 1376 3564 2879.98 2620 3116 122356 122356 0.00%
crit 19.25% 10.13 3 20 5768.92 2816 7127 5778.74 3465 6809 58481 58481 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:31.11
    havoc
    [R]:11.06
  • if_expr:cast_time<havoc_remains
Rain of Fire 886 9.0% 16.4 17.71sec 16284 13035 Periodic 388.0 575 1151 687 19.4% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.36 0.00 0.00 388.03 1.2493 0.0000 266463.34 266463.34 0.00% 13035.09 13035.09
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.62% 312.82 210 447 575.19 527 623 575.21 568 582 179941 179941 0.00%
crit 19.38% 75.20 42 120 1150.59 1054 1246 1150.52 1123 1171 86523 86523 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.14
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.22
Soul Fire 525 5.3% 5.6 49.39sec 28317 8143 Direct 7.6 17389 34476 20910 20.6%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.58 7.56 0.00 0.00 3.4775 0.0000 158071.77 158071.77 0.00% 8143.41 8143.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.44% 6.01 2 10 17388.89 8954 22024 17406.73 13726 21124 104452 104452 0.00%
crit 20.56% 1.56 0 5 34476.20 18005 44041 27961.28 0 44035 53620 53620 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.64
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.04
  • if_expr:cast_time<havoc_remains
Summon Infernal 83 0.8% 2.0 180.56sec 12347 10677 Direct 6.0 3432 6865 4116 19.9%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24694.81 24694.81 0.00% 10676.53 10676.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.09% 4.81 2 6 3432.48 3382 3483 3432.51 3382 3483 16495 16495 0.00%
crit 19.91% 1.19 0 4 6864.95 6764 6966 5112.14 0 6966 8200 8200 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3643 / 736
Immolation 3370 6.8% 39.0 5.49sec 5184 0 Direct 117.0 1448 2895 1728 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 202187.75 202187.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 94.34 78 107 1447.77 1409 1451 1447.77 1447 1449 136582 136582 0.00%
crit 19.37% 22.66 10 39 2895.15 2818 2902 2895.16 2883 2902 65605 65605 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 274 0.6% 41.0 5.25sec 400 279 Direct 41.0 338 675 401 18.6%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16417.61 23450.92 29.99% 278.72 278.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.41% 33.38 25 40 337.64 329 339 337.64 337 338 11269 16097 29.99%
crit 18.59% 7.62 1 16 675.30 658 677 675.30 666 677 5148 7354 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 534 / 534
Firebolt 534 5.4% 93.6 3.21sec 1716 1178 Direct 92.9 1448 2896 1728 19.4%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.58 92.89 0.00 0.00 1.4562 0.0000 160545.05 160545.05 0.00% 1178.10 1178.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 74.91 55 97 1447.97 1395 1451 1447.94 1446 1450 108471 108471 0.00%
crit 19.36% 17.98 7 32 2896.10 2790 2902 2896.00 2879 2902 52074 52074 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:94.02
Simple Action Stats Execute Interval
Venthyr_Draven_War
Havoc 9.6 32.18sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.65 0.00 0.00 0.00 1.2443 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.65
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.2 0.0 8.0sec 8.0sec 4.4sec 53.97% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:Venthyr_Draven_War
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.3s
  • trigger_min/max:1.9s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:53.97%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Draven_War
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Built for War 1.0 98.8 0.0sec 3.0sec 298.0sec 98.99% 0.00% 95.8 (95.8) 0.0

Buff Details

  • buff initial source:Venthyr_Draven_War
  • cooldown name:buff_built_for_war
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:3.0s / 3.0s
  • trigger_pct:100.00%
  • duration_min/max:237.7s / 357.0s

Stack Uptimes

  • built_for_war_1:1.01%
  • built_for_war_2:1.01%
  • built_for_war_3:1.01%
  • built_for_war_4:95.96%

Spelldata

  • id:332842
  • name:Built for War
  • tooltip:$pri increased by $w1%.
  • description:{$@spelldesc319973=While you are above {$s1=80}% health you gain {$332842s1=1}% $pri every $t1 sec, stacking up to {$332842u=4} times. If you fall below {$s2=50}% health, this effect is lost.}
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_Draven_War_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.3s
  • trigger_min/max:180.0s / 185.3s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_Draven_War_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.3s
  • trigger_min/max:180.0s / 185.3s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 11.56% 7.93% 14.73% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Draven_War
soul_fire Soul Shard 6.59 7.24 7.72% 1.10 0.39 5.07%
immolate Soul Shard 347.03 33.45 35.69% 0.10 1.25 3.61%
incinerate Soul Shard 41.93 10.58 11.29% 0.25 0.00 0.02%
conflagrate Soul Shard 37.16 27.95 29.83% 0.75 0.00 0.00%
mana_regen Mana 657.56 122356.90 100.00% 186.08 27841.80 18.54%
immolate_crits Soul Shard 33.40 3.22 3.44% 0.10 0.12 3.52%
incinerate_crits Soul Shard 10.16 1.02 1.08% 0.10 0.00 0.00%
infernal Soul Shard 120.00 10.25 10.94% 0.09 1.75 14.58%
pet - imp
energy_regen Energy 362.19 3571.98 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 406.46 409.76 27874.4 49005.7 46642.5 50000.0
Soul Shard 4.0 0.31 0.31 3.5 2.1 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_Draven_War
cataclysm Mana 9.7 4852.3 500.0 500.4 49.7
channel_demonfire Mana 12.3 9201.8 750.0 750.0 34.8
chaos_bolt Soul Shard 22.7 45.5 2.0 2.0 12563.7
conflagrate Mana 37.2 18578.5 500.0 499.7 13.4
havoc Mana 9.7 9654.7 1000.0 1000.7 0.0
immolate Mana 28.2 21137.6 750.0 749.8 23.8
impending_catastrophe Mana 4.7 9412.1 2000.0 2003.2 7.5
incinerate Mana 41.9 41930.0 1000.0 1000.2 4.3
rain_of_fire Soul Shard 16.4 49.1 3.0 3.0 5428.4
soul_fire Mana 6.6 6592.5 1000.0 1181.0 24.0
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.3
pet - imp
firebolt Energy 93.6 3742.8 40.0 40.0 42.9

Statistics & Data Analysis

Fight Length
Venthyr_Draven_War Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
Venthyr_Draven_War Damage Per Second
Count 627
Mean 9874.18
Minimum 9322.63
Maximum 10595.10
Spread ( max - min ) 1272.47
Range [ ( max - min ) / 2 * 100% ] 6.44%
Standard Deviation 222.2400
5th Percentile 9546.17
95th Percentile 10277.34
( 95th Percentile - 5th Percentile ) 731.17
Mean Distribution
Standard Deviation 8.8754
95.00% Confidence Interval ( 9856.78 - 9891.57 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1946
0.1 Scale Factor Error with Delta=300 422
0.05 Scale Factor Error with Delta=300 1687
0.01 Scale Factor Error with Delta=300 42163
Priority Target DPS
Venthyr_Draven_War Priority Target Damage Per Second
Count 627
Mean 5278.30
Minimum 4969.08
Maximum 5767.45
Spread ( max - min ) 798.36
Range [ ( max - min ) / 2 * 100% ] 7.56%
Standard Deviation 132.6912
5th Percentile 5079.69
95th Percentile 5514.83
( 95th Percentile - 5th Percentile ) 435.13
Mean Distribution
Standard Deviation 5.2992
95.00% Confidence Interval ( 5267.92 - 5288.69 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2428
0.1 Scale Factor Error with Delta=300 151
0.05 Scale Factor Error with Delta=300 602
0.01 Scale Factor Error with Delta=300 15031
DPS(e)
Venthyr_Draven_War Damage Per Second (Effective)
Count 627
Mean 9874.18
Minimum 9322.63
Maximum 10595.10
Spread ( max - min ) 1272.47
Range [ ( max - min ) / 2 * 100% ] 6.44%
Damage
Venthyr_Draven_War Damage
Count 627
Mean 2586771.01
Minimum 2060392.28
Maximum 3120216.86
Spread ( max - min ) 1059824.58
Range [ ( max - min ) / 2 * 100% ] 20.49%
DTPS
Venthyr_Draven_War Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Draven_War Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Draven_War Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Draven_War Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Draven_War Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Draven_War Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_Draven_WarTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Draven_War Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.64 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.76 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.14 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.27 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.99 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.65 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.22 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.43 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.73 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 31.11 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.72 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.04 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.31 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.86 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.06 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFDFKLJLDJLALJEHQQRNOFFIFJLEIJLALLHNQQPNQELFFFJKLI9AHNQNQRRPEFJIFLJLLLLIAHRNQRNPR9EIFJKILJLLAHNQQRRNPEFIFMJLLDJ9AHQNQQNPDELJIFKLLFFJLAHQNQRRNP9EFFIJLILJAHRQNQRPEJLLFIKJLLLLA9EHQNQNPQNFILLFE

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.022 cds M summon_infernal Fluffy_Pillow 49761.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, built_for_war
0:05.029 aoe H havoc enemy2 49264.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, built_for_war
0:06.036 havoc Q chaos_bolt Fluffy_Pillow 48768.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, built_for_war(2)
0:08.044 havoc N conflagrate Fluffy_Pillow 49772.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, built_for_war(2)
0:09.050 havoc Q chaos_bolt Fluffy_Pillow 49775.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, built_for_war(3)
0:10.457 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, built_for_war(3)
0:11.464 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft, built_for_war(3)
0:12.470 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft, built_for_war(4)
0:13.876 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, built_for_war(4)
0:14.883 havoc Q chaos_bolt Fluffy_Pillow 49958.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, built_for_war(4)
0:16.288 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust, built_for_war(4)
0:17.295 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, built_for_war(4)
0:18.304 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft, built_for_war(4)
0:20.701 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
bloodlust, backdraft, built_for_war(4)
0:21.707 aoe F immolate enemy2 49252.0/50000: 99% mana
2.9/5: 58% soul_shard
bloodlust, backdraft, built_for_war(4)
0:22.713 aoe D rain_of_fire Fluffy_Pillow 49005.0/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft, built_for_war(4)
0:23.721 aoe F immolate enemy3 49509.0/50000: 99% mana
0.4/5: 8% soul_shard
bloodlust, backdraft, built_for_war(4)
0:24.728 aoe K impending_catastrophe Fluffy_Pillow 49252.5/50000: 99% mana
0.7/5: 14% soul_shard
bloodlust, backdraft, built_for_war(4)
0:26.068 aoe L incinerate Fluffy_Pillow 47922.5/50000: 96% mana
1.1/5: 22% soul_shard
bloodlust, backdraft, built_for_war(4)
0:27.006 aoe J conflagrate Fluffy_Pillow 47391.5/50000: 95% mana
1.6/5: 32% soul_shard
bloodlust, built_for_war(4)
0:28.016 aoe L incinerate Fluffy_Pillow 47396.5/50000: 95% mana
2.5/5: 50% soul_shard
bloodlust, backdraft, built_for_war(4)
0:28.954 aoe D rain_of_fire Fluffy_Pillow 46865.5/50000: 94% mana
3.1/5: 62% soul_shard
bloodlust, built_for_war(4)
0:29.961 aoe J conflagrate Fluffy_Pillow 47369.0/50000: 95% mana
0.4/5: 8% soul_shard
bloodlust, built_for_war(4)
0:30.969 aoe L incinerate Fluffy_Pillow 47373.0/50000: 95% mana
1.3/5: 26% soul_shard
bloodlust, backdraft, built_for_war(4)
0:31.909 default A cataclysm Fluffy_Pillow 46843.0/50000: 94% mana
1.8/5: 36% soul_shard
bloodlust, built_for_war(4)
0:33.250 aoe L incinerate Fluffy_Pillow 47013.5/50000: 94% mana
2.3/5: 46% soul_shard
bloodlust, built_for_war(4)
0:34.589 aoe J conflagrate Fluffy_Pillow 46683.0/50000: 93% mana
2.8/5: 56% soul_shard
bloodlust, built_for_war(4)
0:35.665 aoe E channel_demonfire Fluffy_Pillow 46721.0/50000: 93% mana
3.5/5: 70% soul_shard
bloodlust, backdraft, built_for_war(4)
0:37.905 aoe H havoc enemy2 47091.0/50000: 94% mana
3.9/5: 78% soul_shard
bloodlust, backdraft, built_for_war(4)
0:38.911 havoc Q chaos_bolt Fluffy_Pillow 46594.0/50000: 93% mana
4.1/5: 82% soul_shard
bloodlust, backdraft, built_for_war(4)
0:40.316 havoc Q chaos_bolt Fluffy_Pillow 47296.5/50000: 95% mana
2.2/5: 44% soul_shard
bloodlust, built_for_war(4)
0:42.326 havoc R incinerate Fluffy_Pillow 48301.5/50000: 97% mana
0.5/5: 10% soul_shard
built_for_war(4)
0:44.066 havoc N conflagrate Fluffy_Pillow 48171.5/50000: 96% mana
1.1/5: 22% soul_shard
built_for_war(4)
0:45.372 havoc O soul_fire Fluffy_Pillow 48324.5/50000: 97% mana
2.4/5: 48% soul_shard
backdraft, built_for_war(4)
0:48.849 aoe F immolate enemy2 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, built_for_war(4)
0:50.155 aoe F immolate Fluffy_Pillow 48905.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, built_for_war(4)
0:51.461 aoe I rain_of_fire Fluffy_Pillow 48808.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, built_for_war(4)
0:52.767 aoe F immolate enemy3 49461.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, built_for_war(4)
0:54.073 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.3/5: 46% soul_shard
built_for_war(4)
0:55.379 aoe L incinerate Fluffy_Pillow 49405.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft, built_for_war(4)
0:56.599 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.3/5: 66% soul_shard
built_for_war(4)
0:59.328 aoe I rain_of_fire Fluffy_Pillow 49617.0/50000: 99% mana
3.6/5: 72% soul_shard
built_for_war(4)
1:00.634 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
built_for_war(4)
1:01.942 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
backdraft, built_for_war(4)
1:03.163 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
1.7/5: 34% soul_shard
built_for_war(4)
1:04.985 aoe L incinerate Fluffy_Pillow 49414.0/50000: 99% mana
2.0/5: 40% soul_shard
built_for_war(4)
1:06.726 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.6/5: 52% soul_shard
built_for_war(4)
1:08.466 aoe H havoc enemy2 48872.5/50000: 98% mana
2.9/5: 58% soul_shard
built_for_war(4)
1:09.772 havoc N conflagrate Fluffy_Pillow 48525.5/50000: 97% mana
3.1/5: 62% soul_shard
built_for_war(4)
1:11.079 havoc Q chaos_bolt Fluffy_Pillow 48679.0/50000: 97% mana
4.2/5: 84% soul_shard
backdraft, built_for_war(4)
1:12.906 havoc Q chaos_bolt Fluffy_Pillow 49592.5/50000: 99% mana
2.5/5: 50% soul_shard
built_for_war(4)
1:15.515 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
built_for_war(4)
1:16.820 havoc N conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
1.1/5: 22% soul_shard
built_for_war(4)
1:18.128 havoc Q chaos_bolt Fluffy_Pillow 49405.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, built_for_war(4)
1:19.955 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
built_for_war(4)
1:22.732 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
built_for_war(4)
1:24.471 aoe F immolate enemy3 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
built_for_war(4)
1:25.778 aoe F immolate Fluffy_Pillow 48905.0/50000: 98% mana
1.3/5: 26% soul_shard
built_for_war(4)
1:27.083 aoe F immolate enemy2 48807.5/50000: 98% mana
1.7/5: 34% soul_shard
built_for_war(4)
1:28.389 aoe J conflagrate Fluffy_Pillow 48710.5/50000: 97% mana
1.7/5: 34% soul_shard
built_for_war(4)
1:29.695 aoe K impending_catastrophe Fluffy_Pillow 48863.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, built_for_war(4)
1:31.436 aoe L incinerate Fluffy_Pillow 47734.0/50000: 95% mana
2.6/5: 52% soul_shard
backdraft, built_for_war(4)
1:32.657 aoe I rain_of_fire Fluffy_Pillow 47344.5/50000: 95% mana
3.2/5: 64% soul_shard
built_for_war(4)
1:33.964 default 9 soul_fire Fluffy_Pillow 47998.0/50000: 96% mana
0.2/5: 4% soul_shard
built_for_war(4)
1:37.442 default A cataclysm Fluffy_Pillow 48737.0/50000: 97% mana
1.8/5: 36% soul_shard
built_for_war(4)
1:39.182 aoe H havoc enemy2 49107.0/50000: 98% mana
1.9/5: 38% soul_shard
built_for_war(4)
1:40.489 havoc N conflagrate Fluffy_Pillow 48760.5/50000: 98% mana
2.2/5: 44% soul_shard
built_for_war(4)
1:41.797 havoc Q chaos_bolt Fluffy_Pillow 48914.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, built_for_war(4)
1:43.624 havoc N conflagrate Fluffy_Pillow 49828.0/50000: 100% mana
1.5/5: 30% soul_shard
built_for_war(4)
1:44.931 havoc Q chaos_bolt Fluffy_Pillow 49981.5/50000: 100% mana
2.6/5: 52% soul_shard
backdraft, built_for_war(4)
1:46.757 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
built_for_war(4)
1:48.498 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
built_for_war(4)
1:50.239 havoc P immolate Fluffy_Pillow 48873.0/50000: 98% mana
2.1/5: 42% soul_shard
built_for_war(4)
1:51.547 aoe E channel_demonfire Fluffy_Pillow 48777.0/50000: 98% mana
2.3/5: 46% soul_shard
built_for_war(4)
1:54.406 aoe F immolate enemy2 49456.5/50000: 99% mana
2.6/5: 52% soul_shard
built_for_war(4)
1:55.712 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.8/5: 56% soul_shard
built_for_war(4)
1:57.020 aoe I rain_of_fire Fluffy_Pillow 49406.0/50000: 99% mana
3.3/5: 66% soul_shard
backdraft, built_for_war(4)
1:58.326 aoe F immolate enemy3 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft, built_for_war(4)
1:59.633 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft, built_for_war(4)
2:00.853 aoe J conflagrate Fluffy_Pillow 48862.5/50000: 98% mana
0.9/5: 18% soul_shard
built_for_war(4)
2:02.159 aoe L incinerate Fluffy_Pillow 49015.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft, built_for_war(4)
2:03.377 aoe L incinerate Fluffy_Pillow 48624.5/50000: 97% mana
1.8/5: 36% soul_shard
built_for_war(4)
2:05.118 aoe L incinerate Fluffy_Pillow 48495.0/50000: 97% mana
2.4/5: 48% soul_shard
built_for_war(4)
2:06.858 aoe L incinerate Fluffy_Pillow 48365.0/50000: 97% mana
2.9/5: 58% soul_shard
built_for_war(4)
2:08.599 aoe I rain_of_fire Fluffy_Pillow 48235.5/50000: 96% mana
3.1/5: 62% soul_shard
built_for_war(4)
2:09.907 default A cataclysm Fluffy_Pillow 48889.5/50000: 98% mana
0.5/5: 10% soul_shard
built_for_war(4)
2:11.649 aoe H havoc enemy2 49260.5/50000: 99% mana
0.8/5: 16% soul_shard
built_for_war(4)
2:12.956 havoc R incinerate Fluffy_Pillow 48914.0/50000: 98% mana
0.8/5: 16% soul_shard
built_for_war(4)
2:14.696 havoc N conflagrate Fluffy_Pillow 48784.0/50000: 98% mana
1.5/5: 30% soul_shard
built_for_war(4)
2:16.001 havoc Q chaos_bolt Fluffy_Pillow 48936.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, built_for_war(4)
2:17.830 havoc R incinerate Fluffy_Pillow 49851.0/50000: 100% mana
0.9/5: 18% soul_shard
built_for_war(4)
2:19.572 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.7/5: 34% soul_shard
built_for_war(4)
2:20.879 havoc P immolate Fluffy_Pillow 49156.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, built_for_war(4)
2:22.185 havoc R incinerate Fluffy_Pillow 49059.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, built_for_war(4)
2:23.405 default 9 soul_fire Fluffy_Pillow 48669.5/50000: 97% mana
3.7/5: 74% soul_shard
built_for_war(4)
2:26.881 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
built_for_war(4)
2:29.820 aoe I rain_of_fire Fluffy_Pillow 49721.0/50000: 99% mana
5.0/5: 100% soul_shard
built_for_war(4)
2:31.128 aoe F immolate enemy3 50000.0/50000: 100% mana
2.1/5: 42% soul_shard
built_for_war(4)
2:32.435 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.3/5: 46% soul_shard
built_for_war(4)
2:33.743 aoe K impending_catastrophe Fluffy_Pillow 49406.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft, built_for_war(4)
2:35.484 aoe I rain_of_fire Fluffy_Pillow 48002.5/50000: 96% mana
3.2/5: 64% soul_shard
backdraft, built_for_war(4)
2:36.789 aoe L incinerate Fluffy_Pillow 48655.0/50000: 97% mana
0.2/5: 4% soul_shard
backdraft, built_for_war(4)
2:38.009 aoe J conflagrate Fluffy_Pillow 48265.0/50000: 97% mana
0.7/5: 14% soul_shard
built_for_war(4)
2:39.314 aoe L incinerate Fluffy_Pillow 48417.5/50000: 97% mana
1.2/5: 24% soul_shard
backdraft, built_for_war(4)
2:40.534 aoe L incinerate Fluffy_Pillow 48027.5/50000: 96% mana
1.8/5: 36% soul_shard
built_for_war(4)
2:42.275 default A cataclysm Fluffy_Pillow 47898.0/50000: 96% mana
2.0/5: 40% soul_shard
built_for_war(4)
2:44.015 aoe H havoc enemy2 48268.0/50000: 97% mana
2.4/5: 48% soul_shard
built_for_war(4)
2:45.321 havoc N conflagrate Fluffy_Pillow 47921.0/50000: 96% mana
2.6/5: 52% soul_shard
built_for_war(4)
2:46.627 havoc Q chaos_bolt Fluffy_Pillow 48074.0/50000: 96% mana
3.7/5: 74% soul_shard
backdraft, built_for_war(4)
2:48.454 havoc Q chaos_bolt Fluffy_Pillow 48987.5/50000: 98% mana
2.0/5: 40% soul_shard
built_for_war(4)
2:51.062 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
built_for_war(4)
2:52.802 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.7/5: 14% soul_shard
built_for_war(4)
2:54.541 havoc N conflagrate Fluffy_Pillow 48871.5/50000: 98% mana
1.4/5: 28% soul_shard
built_for_war(4)
2:55.847 havoc P immolate Fluffy_Pillow 49024.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, built_for_war(4)
2:57.153 aoe E channel_demonfire Fluffy_Pillow 48927.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, built_for_war(4)
2:59.966 aoe F immolate enemy2 49584.0/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, built_for_war(4)
3:01.272 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft, built_for_war(4)
3:02.579 aoe F immolate enemy3 49905.5/50000: 100% mana
0.0/5: 0% soul_shard
backdraft, built_for_war(4)
3:03.886 cds M summon_infernal Fluffy_Pillow 49252.5/50000: 99% mana
0.4/5: 8% soul_shard
backdraft, built_for_war(4)
3:05.326 aoe J conflagrate Fluffy_Pillow 48972.5/50000: 98% mana
0.6/5: 12% soul_shard
built_for_war(4)
3:06.633 aoe L incinerate Fluffy_Pillow 49126.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft, built_for_war(4)
3:07.852 aoe L incinerate Fluffy_Pillow 48735.5/50000: 97% mana
2.1/5: 42% soul_shard
built_for_war(4)
3:09.593 aoe D rain_of_fire Fluffy_Pillow 48606.0/50000: 97% mana
3.0/5: 60% soul_shard
built_for_war(4)
3:10.900 aoe J conflagrate Fluffy_Pillow 49259.5/50000: 99% mana
0.2/5: 4% soul_shard
built_for_war(4)
3:12.206 default 9 soul_fire Fluffy_Pillow 49412.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft, built_for_war(4)
3:15.685 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft, built_for_war(4)
3:17.426 aoe H havoc enemy2 49373.5/50000: 99% mana
4.1/5: 82% soul_shard
backdraft, built_for_war(4)
3:18.732 havoc Q chaos_bolt Fluffy_Pillow 49026.5/50000: 98% mana
4.4/5: 88% soul_shard
backdraft, built_for_war(4)
3:20.557 havoc N conflagrate Fluffy_Pillow 49939.0/50000: 100% mana
3.0/5: 60% soul_shard
built_for_war(4)
3:21.862 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft, built_for_war(4)
3:23.688 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
built_for_war(4)
3:26.298 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
built_for_war(4)
3:27.606 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft, built_for_war(4)
3:28.910 aoe D rain_of_fire Fluffy_Pillow 49251.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft, built_for_war(4)
3:30.218 aoe E channel_demonfire Fluffy_Pillow 49905.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft, built_for_war(4)
3:33.115 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
backdraft, built_for_war(4)
3:34.333 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
2.4/5: 48% soul_shard
built_for_war(4)
3:35.690 aoe I rain_of_fire Fluffy_Pillow 49180.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft, built_for_war(4)
3:36.998 aoe F immolate enemy3 49834.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft, built_for_war(4)
3:38.305 aoe K impending_catastrophe Fluffy_Pillow 49252.5/50000: 99% mana
0.4/5: 8% soul_shard
backdraft, built_for_war(4)
3:40.046 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
0.7/5: 14% soul_shard
backdraft, built_for_war(4)
3:41.266 aoe L incinerate Fluffy_Pillow 47612.5/50000: 95% mana
0.9/5: 18% soul_shard
built_for_war(4)
3:43.008 aoe F immolate Fluffy_Pillow 47483.5/50000: 95% mana
1.6/5: 32% soul_shard
built_for_war(4)
3:44.315 aoe F immolate enemy2 47387.0/50000: 95% mana
1.6/5: 32% soul_shard
built_for_war(4)
3:45.620 aoe J conflagrate Fluffy_Pillow 47289.5/50000: 95% mana
1.9/5: 38% soul_shard
built_for_war(4)
3:46.928 aoe L incinerate Fluffy_Pillow 47443.5/50000: 95% mana
2.4/5: 48% soul_shard
backdraft, built_for_war(4)
3:48.149 default A cataclysm Fluffy_Pillow 47054.0/50000: 94% mana
2.9/5: 58% soul_shard
built_for_war(4)
3:49.890 aoe H havoc enemy2 47424.5/50000: 95% mana
3.2/5: 64% soul_shard
built_for_war(4)
3:51.198 havoc Q chaos_bolt Fluffy_Pillow 47078.5/50000: 94% mana
3.3/5: 66% soul_shard
built_for_war(4)
3:53.806 havoc N conflagrate Fluffy_Pillow 48382.5/50000: 97% mana
1.6/5: 32% soul_shard
built_for_war(4)
3:55.114 havoc Q chaos_bolt Fluffy_Pillow 48536.5/50000: 97% mana
2.8/5: 56% soul_shard
backdraft, built_for_war(4)
3:56.942 havoc R incinerate Fluffy_Pillow 49450.5/50000: 99% mana
0.9/5: 18% soul_shard
built_for_war(4)
3:58.681 havoc R incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.6/5: 32% soul_shard
built_for_war(4)
4:00.421 havoc N conflagrate Fluffy_Pillow 48871.5/50000: 98% mana
2.3/5: 46% soul_shard
built_for_war(4)
4:01.728 havoc P immolate Fluffy_Pillow 49025.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, built_for_war(4)
4:03.035 default 9 soul_fire Fluffy_Pillow 48928.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft, built_for_war(4)
4:06.512 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, built_for_war(4)
4:09.445 aoe F immolate enemy2 49718.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, built_for_war(4)
4:10.752 aoe F immolate enemy3 49252.5/50000: 99% mana
5.0/5: 100% soul_shard
built_for_war(4)
4:12.059 aoe I rain_of_fire Fluffy_Pillow 49156.0/50000: 98% mana
5.0/5: 100% soul_shard
built_for_war(4)
4:13.366 aoe J conflagrate Fluffy_Pillow 49809.5/50000: 100% mana
2.3/5: 46% soul_shard
built_for_war(4)
4:14.674 aoe L incinerate Fluffy_Pillow 49963.5/50000: 100% mana
2.9/5: 58% soul_shard
backdraft, built_for_war(4)
4:15.894 aoe I rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.3/5: 66% soul_shard
built_for_war(4)
4:17.200 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
0.5/5: 10% soul_shard
built_for_war(4)
4:18.941 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
built_for_war(4)
4:20.246 default A cataclysm Fluffy_Pillow 49155.0/50000: 98% mana
1.5/5: 30% soul_shard
backdraft, built_for_war(4)
4:21.987 aoe H havoc enemy2 49502.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft, built_for_war(4)
4:23.294 havoc R incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft, built_for_war(4)
4:24.513 havoc Q chaos_bolt Fluffy_Pillow 48765.5/50000: 98% mana
2.6/5: 52% soul_shard
built_for_war(4)
4:27.123 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
built_for_war(4)
4:28.429 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.1/5: 42% soul_shard
backdraft, built_for_war(4)
4:30.257 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
built_for_war(4)
4:31.998 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
built_for_war(4)
4:33.305 aoe E channel_demonfire Fluffy_Pillow 48906.0/50000: 98% mana
1.3/5: 26% soul_shard
built_for_war(4)
4:36.210 aoe J conflagrate Fluffy_Pillow 49608.5/50000: 99% mana
1.7/5: 34% soul_shard
built_for_war(4)
4:37.514 aoe L incinerate Fluffy_Pillow 49760.5/50000: 100% mana
2.5/5: 50% soul_shard
backdraft, built_for_war(4)
4:38.733 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
built_for_war(4)
4:40.475 aoe F immolate enemy3 48873.0/50000: 98% mana
3.4/5: 68% soul_shard
built_for_war(4)
4:41.782 aoe I rain_of_fire Fluffy_Pillow 48776.5/50000: 98% mana
3.4/5: 68% soul_shard
built_for_war(4)
4:43.088 aoe K impending_catastrophe Fluffy_Pillow 49429.5/50000: 99% mana
0.7/5: 14% soul_shard
built_for_war(4)
4:44.830 aoe J conflagrate Fluffy_Pillow 48003.0/50000: 96% mana
0.9/5: 18% soul_shard
built_for_war(4)
4:46.137 aoe L incinerate Fluffy_Pillow 48156.5/50000: 96% mana
1.5/5: 30% soul_shard
backdraft, built_for_war(4)
4:47.356 aoe L incinerate Fluffy_Pillow 47766.0/50000: 96% mana
1.9/5: 38% soul_shard
built_for_war(4)
4:49.096 aoe L incinerate Fluffy_Pillow 47636.0/50000: 95% mana
2.3/5: 46% soul_shard
built_for_war(4)
4:50.836 aoe L incinerate Fluffy_Pillow 47506.0/50000: 95% mana
2.9/5: 58% soul_shard
built_for_war(4)
4:52.577 default A cataclysm Fluffy_Pillow 47376.5/50000: 95% mana
3.3/5: 66% soul_shard
built_for_war(4)
4:54.317 default 9 soul_fire Fluffy_Pillow 47746.5/50000: 95% mana
3.7/5: 74% soul_shard
built_for_war(4)
4:57.794 aoe E channel_demonfire Fluffy_Pillow 48485.0/50000: 97% mana
5.0/5: 100% soul_shard
built_for_war(4)
5:00.691 aoe H havoc enemy2 49183.5/50000: 98% mana
5.0/5: 100% soul_shard
built_for_war(4)
5:01.997 havoc Q chaos_bolt Fluffy_Pillow 48836.5/50000: 98% mana
5.0/5: 100% soul_shard
built_for_war(4)
5:04.605 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
built_for_war(4)
5:05.913 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft, built_for_war(4)
5:07.739 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
built_for_war(4)
5:09.047 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft, built_for_war(4)
5:10.352 havoc Q chaos_bolt Fluffy_Pillow 49251.5/50000: 99% mana
3.7/5: 74% soul_shard
backdraft, built_for_war(4)
5:12.179 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
built_for_war(4)
5:13.487 aoe F immolate enemy3 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft, built_for_war(4)
5:14.794 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft, built_for_war(4)
5:16.100 aoe L incinerate Fluffy_Pillow 49905.5/50000: 100% mana
0.3/5: 6% soul_shard
backdraft, built_for_war(4)
5:17.321 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
0.6/5: 12% soul_shard
built_for_war(4)
5:19.060 aoe F immolate enemy2 48872.5/50000: 98% mana
1.2/5: 24% soul_shard
built_for_war(4)
5:20.365 aoe E channel_demonfire Fluffy_Pillow 48775.0/50000: 98% mana
1.3/5: 26% soul_shard
built_for_war(4)

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_Draven_War"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=319973/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_Nadjia : 9792 dps, 5255 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9791.7 9791.7 17.4 / 0.178% 819.3 / 8.4% 20.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
418.1 414.3 Mana 0.00% 38.9 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Nadjia 9792
Cataclysm 777 8.0% 9.7 32.33sec 24008 14401 Direct 29.2 6705 13428 8002 19.3%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.74 29.22 0.00 0.00 1.6671 0.0000 233880.19 233880.19 0.00% 14401.49 14401.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 23.58 14 33 6704.53 6142 7261 6703.67 6459 6888 158073 158073 0.00%
crit 19.32% 5.65 0 13 13428.08 12283 14521 13376.66 0 14210 75808 75808 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.80
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1083) 0.0% (11.1%) 12.9 23.70sec 25200 9500

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.92 0.00 193.11 0.00 2.6527 0.1606 0.00 0.00 0.00% 9500.16 9500.16

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.91
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1083 11.1% 0.0 0.00sec 0 0 Direct 579.3 471 942 562 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 579.34 0.00 0.00 0.0000 0.0000 325551.49 325551.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 467.28 339 588 470.79 263 976 470.83 445 490 219986 219986 0.00%
crit 19.34% 112.06 68 157 941.91 525 1952 941.93 810 1082 105565 105565 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1365 (1845) 13.9% (18.8%) 22.8 12.68sec 24298 12517 Direct 45.4 (90.2) 0 9030 9030 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.80 45.38 0.00 0.00 1.9412 0.0000 409797.59 409797.59 0.00% 12516.89 12516.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 45.38 30 58 9030.44 5861 12241 9031.01 8824 9241 409798 409798 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.90
  • if_expr:cast_time<havoc_remains
    Internal Combustion 480 4.9% 44.9 12.63sec 3211 0 Direct 44.9 2695 5386 3212 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.87 44.87 0.00 0.00 0.0000 0.0000 144099.72 144099.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 36.24 21 50 2694.86 2 3715 2695.62 2376 2849 97641 97641 0.00%
crit 19.24% 8.63 1 23 5385.88 2 7430 5386.47 3887 6339 46458 46458 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 822 8.4% 38.0 7.78sec 6501 5314 Direct 56.9 3643 7252 4341 19.4%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.00 56.90 0.00 0.00 1.2234 0.0000 247075.19 247075.19 0.00% 5314.13 5314.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 45.89 32 62 3642.56 2047 5042 3642.79 3352 3885 167136 167136 0.00%
crit 19.36% 11.02 3 23 7252.24 4095 10084 7255.15 5493 9036 79939 79939 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:19.08
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.91
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1652 16.9% 28.3 10.19sec 17564 14233 Direct 35.7 1540 3068 1834 19.3%
Periodic 357.1 1012 2026 1208 19.3% 95.9%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.30 35.71 357.13 357.13 1.2340 2.4237 497058.18 497058.18 0.00% 551.99 14232.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 28.82 18 42 1539.92 819 2017 1539.79 1383 1645 44383 44383 0.00%
crit 19.28% 6.89 1 15 3067.77 1639 4033 3060.69 2003 3676 21122 21122 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 288.08 218 354 1012.33 0 1261 1012.40 992 1032 291642 291642 0.00%
crit 19.33% 69.05 42 96 2026.27 5 2521 2026.31 1922 2121 139911 139911 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.84
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.54
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (232) 0.0% (2.4%) 4.7 64.76sec 14872 9495

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.69 0.00 0.00 0.00 1.5665 0.0000 0.00 0.00 0.00% 9494.56 9494.56

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.72
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 13.9 558 1116 666 19.4%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.95 0.00 0.00 0.0000 0.0000 9291.48 9291.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 11.24 5 18 558.02 558 558 558.02 558 558 6274 6274 0.00%
crit 19.38% 2.70 0 8 1116.04 1116 1116 1064.43 0 1116 3017 3017 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 202 2.1% 0.0 0.00sec 0 0 Periodic 106.5 476 952 568 19.3% 18.2%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 106.53 106.53 0.0000 1.5416 60465.04 60465.04 0.00% 368.17 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.74% 86.01 58 109 475.88 38 488 475.80 455 486 40925 40925 0.00%
crit 19.26% 20.52 8 33 952.14 76 977 951.80 800 977 19540 19540 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 598 6.1% 43.4 6.41sec 4148 2916 Direct 54.4 (54.4) 2773 5580 3316 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.45 54.36 0.00 0.00 1.4225 0.0000 180205.41 180205.41 0.00% 2915.85 2915.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 43.86 26 62 2773.17 1339 3426 2775.10 2602 3063 121633 121633 0.00%
crit 19.31% 10.50 2 22 5579.51 2700 6852 5577.67 3185 6511 58573 58573 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:32.34
    havoc
    [R]:11.37
  • if_expr:cast_time<havoc_remains
Rain of Fire 891 9.1% 17.1 17.14sec 15642 12747 Periodic 406.1 553 1105 660 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.12 0.00 0.00 406.08 1.2272 0.0000 267856.51 267856.51 0.00% 12746.57 12746.57
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.68% 327.61 220 438 552.89 507 599 552.85 545 561 181133 181133 0.00%
crit 19.32% 78.47 46 126 1105.19 1013 1198 1105.16 1083 1128 86724 86724 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.32
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.81
Soul Fire 515 5.3% 5.6 49.72sec 27805 8049 Direct 7.7 16847 33788 20089 19.2%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.57 7.71 0.00 0.00 3.4546 0.0000 154945.72 154945.72 0.00% 8048.71 8048.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 6.22 1 10 16846.54 8600 21176 16870.15 12628 20572 104901 104901 0.00%
crit 19.24% 1.48 0 5 33787.71 17249 42347 27231.97 0 42347 50045 50045 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.45
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.21
  • if_expr:cast_time<havoc_remains
Summon Infernal 80 0.8% 2.0 180.95sec 11889 10280 Direct 6.0 3348 6696 3957 18.4%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1566 0.0000 23778.70 23778.70 0.00% 10280.46 10280.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.63% 4.90 1 6 3348.13 3348 3348 3348.13 3348 3348 16399 16399 0.00%
crit 18.37% 1.10 0 5 6696.27 6696 6696 4731.18 0 6696 7380 7380 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3829 / 774
Immolation 3564 7.3% 39.0 5.50sec 5483 0 Direct 117.0 1529 3059 1827 19.5%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213836.60 213836.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.49% 94.17 82 106 1529.07 1395 2023 1529.12 1496 1560 143995 143995 0.00%
crit 19.51% 22.83 11 35 3059.41 2790 4046 3059.62 2830 3426 69841 69841 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.26sec 388 270 Direct 41.0 326 651 388 19.2%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15913.63 22731.04 29.99% 270.16 270.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 33.12 26 39 325.55 326 326 325.55 326 326 10782 15401 29.99%
crit 19.22% 7.88 2 15 651.10 651 651 651.10 651 651 5132 7331 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 524 / 524
Firebolt 524 5.4% 95.5 3.15sec 1648 1152 Direct 94.8 1395 2790 1661 19.1%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.55 94.79 0.00 0.00 1.4308 0.0000 157447.78 157447.78 0.00% 1151.68 1151.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.94% 76.72 54 97 1395.06 1395 1395 1395.06 1395 1395 107030 107030 0.00%
crit 19.06% 18.07 5 33 2790.11 2790 2790 2790.11 2790 2790 50418 50418 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:95.94
Simple Action Stats Execute Interval
Venthyr_Nadjia
Havoc 9.7 32.29sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.66 0.00 0.00 0.00 1.2220 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.67
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 38.0 0.0 7.8sec 7.8sec 4.3sec 53.78% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.2s
  • trigger_min/max:1.9s / 23.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:53.78%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Euphoria 3.4 0.0 78.0sec 78.0sec 9.9sec 11.19% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_euphoria
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:78.0s / 78.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • euphoria_1:11.19%

Spelldata

  • id:331937
  • name:Euphoria
  • tooltip:Filled with the thrill of battle, increasing Haste by $w1%.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill Seeker 4.4 145.6 78.0sec 2.0sec 66.5sec 97.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_thrill_seeker
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 76.0s

Stack Uptimes

  • thrill_seeker_1:2.93%
  • thrill_seeker_3:2.92%
  • thrill_seeker_4:2.90%
  • thrill_seeker_5:2.87%
  • thrill_seeker_6:2.84%
  • thrill_seeker_7:2.82%
  • thrill_seeker_8:2.80%
  • thrill_seeker_9:2.78%
  • thrill_seeker_10:2.76%
  • thrill_seeker_11:2.74%
  • thrill_seeker_12:2.72%
  • thrill_seeker_13:2.69%
  • thrill_seeker_14:2.66%
  • thrill_seeker_15:2.63%
  • thrill_seeker_16:2.61%
  • thrill_seeker_17:2.59%
  • thrill_seeker_18:2.57%
  • thrill_seeker_19:2.55%
  • thrill_seeker_20:2.53%
  • thrill_seeker_21:2.51%
  • thrill_seeker_22:2.49%
  • thrill_seeker_23:2.47%
  • thrill_seeker_24:2.45%
  • thrill_seeker_25:2.43%
  • thrill_seeker_26:2.41%
  • thrill_seeker_27:2.40%
  • thrill_seeker_28:2.39%
  • thrill_seeker_29:2.38%
  • thrill_seeker_30:2.37%
  • thrill_seeker_31:2.36%
  • thrill_seeker_32:2.35%
  • thrill_seeker_33:2.34%
  • thrill_seeker_34:2.33%
  • thrill_seeker_35:2.31%
  • thrill_seeker_36:2.30%
  • thrill_seeker_37:2.30%
  • thrill_seeker_38:2.29%
  • thrill_seeker_39:2.27%

Spelldata

  • id:331939
  • name:Thrill Seeker
  • tooltip:At {$u=40} stacks, you will gain Euphoria.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
infernal - infernal: Embers 2.0 0.0 180.9sec 180.9sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.2s
  • trigger_min/max:180.0s / 186.2s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.9sec 180.9sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.2s
  • trigger_min/max:180.0s / 186.2s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.60% 7.19% 14.23% 0.8s 0.0s 6.3s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Nadjia
soul_fire Soul Shard 6.58 7.30 7.58% 1.11 0.47 6.05%
immolate Soul Shard 357.10 34.51 35.87% 0.10 1.20 3.37%
incinerate Soul Shard 43.45 10.94 11.37% 0.25 0.01 0.09%
conflagrate Soul Shard 37.99 28.45 29.57% 0.75 0.00 0.00%
mana_regen Mana 686.48 124713.78 100.00% 181.67 25473.01 16.96%
immolate_crits Soul Shard 34.52 3.34 3.47% 0.10 0.11 3.25%
incinerate_crits Soul Shard 10.51 1.05 1.09% 0.10 0.00 0.06%
infernal Soul Shard 120.00 10.62 11.04% 0.09 1.38 11.53%
pet - imp
energy_regen Energy 373.26 3649.94 100.00% 9.78 22.74 0.62%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 414.31 418.13 25499.5 48852.4 46381.5 50000.0
Soul Shard 4.0 0.32 0.32 3.2 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_Nadjia
cataclysm Mana 9.7 4874.0 500.0 500.3 48.0
channel_demonfire Mana 12.9 9681.2 750.0 749.4 33.6
chaos_bolt Soul Shard 22.8 45.6 2.0 2.0 12158.8
conflagrate Mana 38.0 18996.1 500.0 499.8 13.0
havoc Mana 9.7 9665.6 1000.0 1000.4 0.0
immolate Mana 28.3 21220.5 750.0 749.8 23.4
impending_catastrophe Mana 4.7 9393.5 2000.0 2002.6 7.4
incinerate Mana 43.4 43447.9 1000.0 1000.0 4.1
rain_of_fire Soul Shard 17.1 51.4 3.0 3.0 5213.9
soul_fire Mana 6.6 6578.5 1000.0 1180.5 23.6
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.9
pet - imp
firebolt Energy 95.5 3821.3 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
Venthyr_Nadjia Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
Venthyr_Nadjia Damage Per Second
Count 627
Mean 9791.74
Minimum 9282.91
Maximum 10540.58
Spread ( max - min ) 1257.66
Range [ ( max - min ) / 2 * 100% ] 6.42%
Standard Deviation 222.2481
5th Percentile 9468.03
95th Percentile 10182.34
( 95th Percentile - 5th Percentile ) 714.31
Mean Distribution
Standard Deviation 8.8757
95.00% Confidence Interval ( 9774.34 - 9809.13 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1980
0.1 Scale Factor Error with Delta=300 422
0.05 Scale Factor Error with Delta=300 1687
0.01 Scale Factor Error with Delta=300 42166
Priority Target DPS
Venthyr_Nadjia Priority Target Damage Per Second
Count 627
Mean 5255.23
Minimum 4956.93
Maximum 5675.31
Spread ( max - min ) 718.39
Range [ ( max - min ) / 2 * 100% ] 6.83%
Standard Deviation 128.9156
5th Percentile 5051.71
95th Percentile 5480.20
( 95th Percentile - 5th Percentile ) 428.49
Mean Distribution
Standard Deviation 5.1484
95.00% Confidence Interval ( 5245.14 - 5265.32 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2312
0.1 Scale Factor Error with Delta=300 142
0.05 Scale Factor Error with Delta=300 568
0.01 Scale Factor Error with Delta=300 14188
DPS(e)
Venthyr_Nadjia Damage Per Second (Effective)
Count 627
Mean 9791.74
Minimum 9282.91
Maximum 10540.58
Spread ( max - min ) 1257.66
Range [ ( max - min ) / 2 * 100% ] 6.42%
Damage
Venthyr_Nadjia Damage
Count 627
Mean 2554005.22
Minimum 2025474.73
Maximum 3078360.90
Spread ( max - min ) 1052886.17
Range [ ( max - min ) / 2 * 100% ] 20.61%
DTPS
Venthyr_Nadjia Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Nadjia Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Nadjia Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Nadjia Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Nadjia Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Nadjia Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_NadjiaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Nadjia Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.45 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.80 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.32 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.91 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.84 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.67 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.81 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 19.08 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.72 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 32.34 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.91 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.21 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.54 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.90 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.37 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFDKLJLJDLALJEHQQRNOFFIFJIELJLALLHNQQPNQELFJFFKLLI9AHNQNQRNPEFILFJLLLLIJAHRQRNPQ9EJFIKFLJLLJAHQQRRNPEILJLFLMJDLL9AEHQNQNPQNDLKFFEFIJLAJHQRRNQPR9EFIJLJFILLAHNQRQRPNEKLFIJLLJL9AHQNQQPEJLLJFFIFLJL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.909 cds M summon_infernal Fluffy_Pillow 49704.5/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust, thrill_seeker
0:04.917 aoe H havoc enemy2 49208.5/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust, thrill_seeker(3)
0:05.924 havoc Q chaos_bolt Fluffy_Pillow 48712.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust, thrill_seeker(3)
0:07.931 havoc N conflagrate Fluffy_Pillow 49715.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(4)
0:08.937 havoc Q chaos_bolt Fluffy_Pillow 49718.5/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, thrill_seeker(5)
0:10.345 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, thrill_seeker(6)
0:11.354 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft, thrill_seeker(6)
0:12.359 havoc Q chaos_bolt Fluffy_Pillow 49251.5/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft, thrill_seeker(7)
0:13.766 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust, thrill_seeker(7)
0:14.772 havoc Q chaos_bolt Fluffy_Pillow 49958.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, thrill_seeker(8)
0:16.178 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust, thrill_seeker(9)
0:17.185 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, thrill_seeker(9)
0:18.191 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft, thrill_seeker(10)
0:20.632 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft, thrill_seeker(11)
0:21.639 aoe F immolate enemy2 49252.5/50000: 99% mana
2.7/5: 54% soul_shard
bloodlust, backdraft, thrill_seeker(11)
0:22.646 aoe F immolate enemy3 49006.0/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft, thrill_seeker(12)
0:23.653 aoe D rain_of_fire Fluffy_Pillow 48759.5/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft, thrill_seeker(12)
0:24.657 aoe K impending_catastrophe Fluffy_Pillow 49261.5/50000: 99% mana
0.7/5: 14% soul_shard
bloodlust, backdraft, thrill_seeker(13)
0:25.998 aoe L incinerate Fluffy_Pillow 47932.0/50000: 96% mana
1.2/5: 24% soul_shard
bloodlust, backdraft, thrill_seeker(13)
0:26.937 aoe J conflagrate Fluffy_Pillow 47401.5/50000: 95% mana
1.7/5: 34% soul_shard
bloodlust, thrill_seeker(14)
0:27.945 aoe L incinerate Fluffy_Pillow 47405.5/50000: 95% mana
2.6/5: 52% soul_shard
bloodlust, backdraft, thrill_seeker(14)
0:28.884 aoe J conflagrate Fluffy_Pillow 46875.0/50000: 94% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(15)
0:29.890 aoe D rain_of_fire Fluffy_Pillow 46878.0/50000: 94% mana
4.0/5: 80% soul_shard
bloodlust, backdraft, thrill_seeker(15)
0:30.896 aoe L incinerate Fluffy_Pillow 47381.0/50000: 95% mana
1.3/5: 26% soul_shard
bloodlust, backdraft, thrill_seeker(16)
0:31.835 default A cataclysm Fluffy_Pillow 46850.5/50000: 94% mana
1.9/5: 38% soul_shard
bloodlust, thrill_seeker(16)
0:33.176 aoe L incinerate Fluffy_Pillow 47021.0/50000: 94% mana
2.4/5: 48% soul_shard
bloodlust, thrill_seeker(17)
0:34.517 aoe J conflagrate Fluffy_Pillow 46691.5/50000: 93% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(18)
0:35.550 aoe E channel_demonfire Fluffy_Pillow 46708.0/50000: 93% mana
3.6/5: 72% soul_shard
bloodlust, backdraft, thrill_seeker(18)
0:37.775 aoe H havoc enemy2 47070.5/50000: 94% mana
4.1/5: 82% soul_shard
bloodlust, backdraft, thrill_seeker(19)
0:38.782 havoc Q chaos_bolt Fluffy_Pillow 46574.0/50000: 93% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, thrill_seeker(20)
0:40.187 havoc Q chaos_bolt Fluffy_Pillow 47276.5/50000: 95% mana
2.4/5: 48% soul_shard
bloodlust, thrill_seeker(21)
0:42.195 havoc R incinerate Fluffy_Pillow 48280.5/50000: 97% mana
0.8/5: 16% soul_shard
thrill_seeker(22)
0:43.934 havoc N conflagrate Fluffy_Pillow 48150.0/50000: 96% mana
1.3/5: 26% soul_shard
thrill_seeker(22)
0:45.240 havoc O soul_fire Fluffy_Pillow 48303.0/50000: 97% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(23)
0:48.717 aoe F immolate enemy2 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(25)
0:50.023 aoe F immolate Fluffy_Pillow 48905.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(26)
0:51.329 aoe I rain_of_fire Fluffy_Pillow 48808.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(26)
0:52.636 aoe F immolate enemy3 49461.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, thrill_seeker(27)
0:53.944 aoe J conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
2.3/5: 46% soul_shard
thrill_seeker(27)
0:55.252 aoe I rain_of_fire Fluffy_Pillow 49407.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft, thrill_seeker(28)
0:56.558 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.1/5: 2% soul_shard
backdraft, thrill_seeker(29)
0:59.378 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft, thrill_seeker(30)
1:00.597 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
thrill_seeker(31)
1:01.903 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft, thrill_seeker(31)
1:03.121 default A cataclysm Fluffy_Pillow 48764.0/50000: 98% mana
1.9/5: 38% soul_shard
thrill_seeker(32)
1:04.912 aoe L incinerate Fluffy_Pillow 49159.5/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(33)
1:06.654 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.5/5: 50% soul_shard
thrill_seeker(34)
1:08.394 aoe H havoc enemy2 48873.0/50000: 98% mana
2.9/5: 58% soul_shard
thrill_seeker(35)
1:09.700 havoc N conflagrate Fluffy_Pillow 48526.0/50000: 97% mana
3.0/5: 60% soul_shard
thrill_seeker(35)
1:11.006 havoc Q chaos_bolt Fluffy_Pillow 48679.0/50000: 97% mana
4.3/5: 86% soul_shard
backdraft, thrill_seeker(36)
1:12.831 havoc Q chaos_bolt Fluffy_Pillow 49591.5/50000: 99% mana
2.4/5: 48% soul_shard
thrill_seeker(37)
1:15.441 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
thrill_seeker(38)
1:16.749 havoc N conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.0/5: 20% soul_shard
thrill_seeker(39)
1:18.056 havoc Q chaos_bolt Fluffy_Pillow 49406.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft, euphoria
1:19.578 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
euphoria
1:21.986 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
thrill_seeker, euphoria
1:23.437 aoe F immolate enemy3 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
thrill_seeker(3), euphoria
1:24.526 aoe J conflagrate Fluffy_Pillow 48796.5/50000: 98% mana
1.2/5: 24% soul_shard
thrill_seeker(4), euphoria
1:25.617 aoe F immolate Fluffy_Pillow 48842.0/50000: 98% mana
2.0/5: 40% soul_shard
backdraft, thrill_seeker(4), euphoria
1:26.707 aoe F immolate enemy2 48637.0/50000: 97% mana
2.0/5: 40% soul_shard
backdraft, thrill_seeker(5), euphoria
1:27.797 aoe K impending_catastrophe Fluffy_Pillow 48432.0/50000: 97% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(5), euphoria
1:29.250 aoe L incinerate Fluffy_Pillow 47158.5/50000: 94% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(6)
1:30.468 aoe L incinerate Fluffy_Pillow 46767.5/50000: 94% mana
2.8/5: 56% soul_shard
thrill_seeker(7)
1:32.208 aoe I rain_of_fire Fluffy_Pillow 46637.5/50000: 93% mana
3.2/5: 64% soul_shard
thrill_seeker(8)
1:33.516 default 9 soul_fire Fluffy_Pillow 47291.5/50000: 95% mana
0.3/5: 6% soul_shard
thrill_seeker(8)
1:37.190 default A cataclysm Fluffy_Pillow 48128.5/50000: 96% mana
1.8/5: 36% soul_shard
thrill_seeker(10)
1:38.930 aoe H havoc enemy2 48498.5/50000: 97% mana
2.0/5: 40% soul_shard
thrill_seeker(11)
1:40.237 havoc N conflagrate Fluffy_Pillow 48152.0/50000: 96% mana
2.2/5: 44% soul_shard
thrill_seeker(12)
1:41.543 havoc Q chaos_bolt Fluffy_Pillow 48305.0/50000: 97% mana
3.3/5: 66% soul_shard
backdraft, thrill_seeker(12)
1:43.371 havoc N conflagrate Fluffy_Pillow 49219.0/50000: 98% mana
1.7/5: 34% soul_shard
thrill_seeker(13)
1:44.677 havoc Q chaos_bolt Fluffy_Pillow 49372.0/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(14)
1:46.504 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
thrill_seeker(15)
1:48.244 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
thrill_seeker(16)
1:49.751 havoc P immolate Fluffy_Pillow 49255.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(16)
1:51.058 aoe E channel_demonfire Fluffy_Pillow 49159.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft, thrill_seeker(17)
1:53.857 aoe F immolate enemy2 49808.5/50000: 100% mana
3.4/5: 68% soul_shard
backdraft, thrill_seeker(18)
1:55.164 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.5/5: 70% soul_shard
backdraft, thrill_seeker(19)
1:56.471 aoe L incinerate Fluffy_Pillow 49906.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft, thrill_seeker(20)
1:57.690 aoe F immolate enemy3 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
thrill_seeker(20)
1:58.996 aoe J conflagrate Fluffy_Pillow 48905.0/50000: 98% mana
1.1/5: 22% soul_shard
thrill_seeker(21)
2:00.304 aoe L incinerate Fluffy_Pillow 49059.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft, thrill_seeker(22)
2:01.524 aoe L incinerate Fluffy_Pillow 48669.0/50000: 97% mana
2.1/5: 42% soul_shard
thrill_seeker(22)
2:03.263 aoe L incinerate Fluffy_Pillow 48538.5/50000: 97% mana
2.5/5: 50% soul_shard
thrill_seeker(23)
2:05.003 aoe L incinerate Fluffy_Pillow 48408.5/50000: 97% mana
2.8/5: 56% soul_shard
thrill_seeker(24)
2:06.745 aoe I rain_of_fire Fluffy_Pillow 48279.5/50000: 97% mana
3.4/5: 68% soul_shard
thrill_seeker(25)
2:08.052 aoe J conflagrate Fluffy_Pillow 48933.0/50000: 98% mana
0.4/5: 8% soul_shard
thrill_seeker(26)
2:09.358 default A cataclysm Fluffy_Pillow 49086.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft, thrill_seeker(26)
2:11.099 aoe H havoc enemy2 49456.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft, thrill_seeker(27)
2:12.406 havoc R incinerate Fluffy_Pillow 49110.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft, thrill_seeker(28)
2:13.627 havoc Q chaos_bolt Fluffy_Pillow 48720.5/50000: 97% mana
2.3/5: 46% soul_shard
thrill_seeker(28)
2:16.237 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
thrill_seeker(30)
2:17.979 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
thrill_seeker(30)
2:19.285 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(31)
2:20.593 havoc Q chaos_bolt Fluffy_Pillow 49060.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(32)
2:22.420 default 9 soul_fire Fluffy_Pillow 49973.5/50000: 100% mana
0.8/5: 16% soul_shard
thrill_seeker(33)
2:25.897 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
thrill_seeker(34)
2:28.740 aoe J conflagrate Fluffy_Pillow 49673.5/50000: 99% mana
2.4/5: 48% soul_shard
thrill_seeker(36)
2:30.045 aoe F immolate enemy3 49826.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft, thrill_seeker(37)
2:31.350 aoe I rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft, thrill_seeker(37)
2:32.658 aoe K impending_catastrophe Fluffy_Pillow 49905.5/50000: 100% mana
0.5/5: 10% soul_shard
backdraft, thrill_seeker(38)
2:34.398 aoe F immolate enemy2 48002.0/50000: 96% mana
0.7/5: 14% soul_shard
backdraft, thrill_seeker(39)
2:35.704 aoe L incinerate Fluffy_Pillow 47905.0/50000: 96% mana
0.8/5: 16% soul_shard
backdraft, thrill_seeker(39)
2:36.922 aoe J conflagrate Fluffy_Pillow 47514.0/50000: 95% mana
1.2/5: 24% soul_shard
euphoria
2:38.012 aoe L incinerate Fluffy_Pillow 47559.0/50000: 95% mana
1.8/5: 36% soul_shard
backdraft, thrill_seeker, euphoria
2:39.029 aoe L incinerate Fluffy_Pillow 47067.5/50000: 94% mana
2.3/5: 46% soul_shard
thrill_seeker, euphoria
2:40.480 aoe J conflagrate Fluffy_Pillow 46793.0/50000: 94% mana
2.6/5: 52% soul_shard
thrill_seeker(3), euphoria
2:41.569 default A cataclysm Fluffy_Pillow 46837.5/50000: 94% mana
3.5/5: 70% soul_shard
backdraft, thrill_seeker(3), euphoria
2:43.022 aoe H havoc enemy2 47064.0/50000: 94% mana
3.5/5: 70% soul_shard
backdraft, thrill_seeker(4), euphoria
2:44.111 havoc Q chaos_bolt Fluffy_Pillow 46608.5/50000: 93% mana
3.8/5: 76% soul_shard
backdraft, thrill_seeker(5), euphoria
2:45.634 havoc Q chaos_bolt Fluffy_Pillow 47370.0/50000: 95% mana
2.0/5: 40% soul_shard
thrill_seeker(5), euphoria
2:47.810 havoc R incinerate Fluffy_Pillow 48458.0/50000: 97% mana
0.3/5: 6% soul_shard
thrill_seeker(6)
2:49.551 havoc R incinerate Fluffy_Pillow 48328.5/50000: 97% mana
0.8/5: 16% soul_shard
thrill_seeker(7)
2:51.292 havoc N conflagrate Fluffy_Pillow 48199.0/50000: 96% mana
1.5/5: 30% soul_shard
thrill_seeker(8)
2:52.599 havoc P immolate Fluffy_Pillow 48352.5/50000: 97% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(9)
2:53.905 aoe E channel_demonfire Fluffy_Pillow 48255.5/50000: 97% mana
2.9/5: 58% soul_shard
backdraft, thrill_seeker(9)
2:56.674 aoe I rain_of_fire Fluffy_Pillow 48890.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, thrill_seeker(11)
2:57.979 aoe L incinerate Fluffy_Pillow 49542.5/50000: 99% mana
0.2/5: 4% soul_shard
backdraft, thrill_seeker(11)
2:59.199 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
thrill_seeker(12)
3:00.504 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft, thrill_seeker(13)
3:01.723 aoe F immolate enemy3 48764.5/50000: 98% mana
1.9/5: 38% soul_shard
thrill_seeker(13)
3:03.029 aoe L incinerate Fluffy_Pillow 48667.5/50000: 97% mana
1.9/5: 38% soul_shard
thrill_seeker(14)
3:04.769 cds M summon_infernal Fluffy_Pillow 48537.5/50000: 97% mana
2.5/5: 50% soul_shard
thrill_seeker(15)
3:06.076 aoe J conflagrate Fluffy_Pillow 48191.0/50000: 96% mana
2.9/5: 58% soul_shard
thrill_seeker(16)
3:07.382 aoe D rain_of_fire Fluffy_Pillow 48344.0/50000: 97% mana
3.9/5: 78% soul_shard
backdraft, thrill_seeker(16)
3:08.688 aoe L incinerate Fluffy_Pillow 48997.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft, thrill_seeker(17)
3:09.908 aoe L incinerate Fluffy_Pillow 48607.0/50000: 97% mana
1.9/5: 38% soul_shard
thrill_seeker(17)
3:11.649 default 9 soul_fire Fluffy_Pillow 48477.5/50000: 97% mana
2.7/5: 54% soul_shard
thrill_seeker(18)
3:15.124 default A cataclysm Fluffy_Pillow 49001.0/50000: 98% mana
4.9/5: 98% soul_shard
thrill_seeker(20)
3:16.866 aoe E channel_demonfire Fluffy_Pillow 49372.0/50000: 99% mana
5.0/5: 100% soul_shard
thrill_seeker(21)
3:19.739 aoe H havoc enemy2 50000.0/50000: 100% mana
5.0/5: 100% soul_shard
thrill_seeker(22)
3:21.045 havoc Q chaos_bolt Fluffy_Pillow 49653.0/50000: 99% mana
5.0/5: 100% soul_shard
thrill_seeker(23)
3:23.654 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(24)
3:24.960 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft, thrill_seeker(25)
3:26.788 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(26)
3:28.094 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft, thrill_seeker(27)
3:29.402 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.8/5: 96% soul_shard
backdraft, thrill_seeker(27)
3:31.228 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(28)
3:32.535 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft, thrill_seeker(29)
3:33.842 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft, thrill_seeker(29)
3:35.063 aoe K impending_catastrophe Fluffy_Pillow 49003.0/50000: 98% mana
2.6/5: 52% soul_shard
thrill_seeker(30)
3:36.803 aoe F immolate enemy3 47873.0/50000: 96% mana
2.6/5: 52% soul_shard
thrill_seeker(31)
3:38.111 aoe F immolate enemy2 47777.0/50000: 96% mana
2.9/5: 58% soul_shard
thrill_seeker(32)
3:39.418 aoe E channel_demonfire Fluffy_Pillow 47680.5/50000: 95% mana
2.9/5: 58% soul_shard
thrill_seeker(32)
3:42.340 aoe F immolate Fluffy_Pillow 48391.5/50000: 97% mana
3.3/5: 66% soul_shard
thrill_seeker(34)
3:43.646 aoe I rain_of_fire Fluffy_Pillow 48294.5/50000: 97% mana
3.6/5: 72% soul_shard
thrill_seeker(34)
3:44.953 aoe J conflagrate Fluffy_Pillow 48948.0/50000: 98% mana
0.7/5: 14% soul_shard
thrill_seeker(35)
3:46.259 aoe L incinerate Fluffy_Pillow 49101.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft, thrill_seeker(36)
3:47.479 default A cataclysm Fluffy_Pillow 48711.0/50000: 97% mana
1.6/5: 32% soul_shard
thrill_seeker(36)
3:49.219 aoe J conflagrate Fluffy_Pillow 49081.0/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(37)
3:50.524 aoe H havoc enemy2 49233.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(38)
3:51.830 havoc Q chaos_bolt Fluffy_Pillow 48886.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, thrill_seeker(38)
3:53.659 havoc R incinerate Fluffy_Pillow 49801.0/50000: 100% mana
1.1/5: 22% soul_shard
thrill_seeker(39)
3:55.399 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
euphoria
3:56.850 havoc N conflagrate Fluffy_Pillow 48727.5/50000: 97% mana
2.3/5: 46% soul_shard
thrill_seeker, euphoria
3:57.939 havoc Q chaos_bolt Fluffy_Pillow 48772.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft, thrill_seeker, euphoria
3:59.461 havoc P immolate Fluffy_Pillow 49533.0/50000: 99% mana
1.8/5: 36% soul_shard
thrill_seeker(3), euphoria
4:00.548 havoc R incinerate Fluffy_Pillow 49251.0/50000: 99% mana
2.0/5: 40% soul_shard
thrill_seeker(4), euphoria
4:01.999 default 9 soul_fire Fluffy_Pillow 48976.5/50000: 98% mana
2.7/5: 54% soul_shard
thrill_seeker(4), euphoria
4:04.896 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
4.1/5: 82% soul_shard
thrill_seeker(6)
4:07.695 aoe F immolate enemy3 49651.0/50000: 99% mana
4.5/5: 90% soul_shard
thrill_seeker(7)
4:09.003 aoe I rain_of_fire Fluffy_Pillow 49253.0/50000: 99% mana
4.5/5: 90% soul_shard
thrill_seeker(8)
4:10.309 aoe J conflagrate Fluffy_Pillow 49906.0/50000: 100% mana
1.9/5: 38% soul_shard
thrill_seeker(9)
4:11.615 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(9)
4:12.834 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.9/5: 58% soul_shard
thrill_seeker(10)
4:14.140 aoe F immolate enemy2 49155.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, thrill_seeker(11)
4:15.446 aoe I rain_of_fire Fluffy_Pillow 49058.0/50000: 98% mana
3.7/5: 74% soul_shard
backdraft, thrill_seeker(11)
4:16.753 aoe L incinerate Fluffy_Pillow 49711.5/50000: 99% mana
0.7/5: 14% soul_shard
backdraft, thrill_seeker(12)
4:17.969 aoe L incinerate Fluffy_Pillow 49000.5/50000: 98% mana
1.3/5: 26% soul_shard
thrill_seeker(12)
4:19.709 default A cataclysm Fluffy_Pillow 48870.5/50000: 98% mana
1.6/5: 32% soul_shard
thrill_seeker(13)
4:21.448 aoe H havoc enemy2 49240.0/50000: 98% mana
1.8/5: 36% soul_shard
thrill_seeker(14)
4:22.754 havoc N conflagrate Fluffy_Pillow 48893.0/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(15)
4:24.062 havoc Q chaos_bolt Fluffy_Pillow 49047.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft, thrill_seeker(16)
4:25.890 havoc R incinerate Fluffy_Pillow 49961.0/50000: 100% mana
1.4/5: 28% soul_shard
thrill_seeker(16)
4:27.631 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(17)
4:30.242 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
thrill_seeker(19)
4:31.982 havoc P immolate Fluffy_Pillow 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
thrill_seeker(19)
4:33.290 havoc N conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
1.0/5: 20% soul_shard
thrill_seeker(20)
4:34.595 aoe E channel_demonfire Fluffy_Pillow 49058.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft, thrill_seeker(21)
4:37.488 aoe K impending_catastrophe Fluffy_Pillow 49755.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(22)
4:39.228 aoe L incinerate Fluffy_Pillow 48002.0/50000: 96% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(23)
4:40.448 aoe F immolate enemy3 47612.0/50000: 95% mana
3.0/5: 60% soul_shard
thrill_seeker(24)
4:41.755 aoe I rain_of_fire Fluffy_Pillow 47515.5/50000: 95% mana
3.3/5: 66% soul_shard
thrill_seeker(24)
4:43.063 aoe J conflagrate Fluffy_Pillow 48169.5/50000: 96% mana
0.3/5: 6% soul_shard
thrill_seeker(25)
4:44.371 aoe L incinerate Fluffy_Pillow 48323.5/50000: 97% mana
1.1/5: 22% soul_shard
backdraft, thrill_seeker(26)
4:45.590 aoe L incinerate Fluffy_Pillow 47933.0/50000: 96% mana
1.3/5: 26% soul_shard
thrill_seeker(26)
4:47.331 aoe J conflagrate Fluffy_Pillow 47803.5/50000: 96% mana
1.8/5: 36% soul_shard
thrill_seeker(27)
4:48.637 aoe L incinerate Fluffy_Pillow 47956.5/50000: 96% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(28)
4:49.857 default 9 soul_fire Fluffy_Pillow 47566.5/50000: 95% mana
2.8/5: 56% soul_shard
thrill_seeker(28)
4:53.372 default A cataclysm Fluffy_Pillow 48324.0/50000: 97% mana
4.3/5: 86% soul_shard
thrill_seeker(30)
4:55.113 aoe H havoc enemy2 48694.5/50000: 97% mana
4.5/5: 90% soul_shard
thrill_seeker(31)
4:56.419 havoc Q chaos_bolt Fluffy_Pillow 48347.5/50000: 97% mana
4.6/5: 92% soul_shard
thrill_seeker(32)
4:59.029 havoc N conflagrate Fluffy_Pillow 49652.5/50000: 99% mana
2.9/5: 58% soul_shard
thrill_seeker(33)
5:00.334 havoc Q chaos_bolt Fluffy_Pillow 49805.0/50000: 100% mana
4.1/5: 82% soul_shard
backdraft, thrill_seeker(34)
5:02.162 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
thrill_seeker(35)
5:04.770 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
thrill_seeker(36)
5:06.075 aoe E channel_demonfire Fluffy_Pillow 49251.5/50000: 99% mana
0.6/5: 12% soul_shard
thrill_seeker(37)
5:08.952 aoe J conflagrate Fluffy_Pillow 49940.0/50000: 100% mana
1.0/5: 20% soul_shard
thrill_seeker(38)
5:10.260 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
backdraft, thrill_seeker(39)
5:11.478 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(39)
5:13.219 aoe J conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.3/5: 46% soul_shard
euphoria
5:14.307 aoe F immolate enemy3 48916.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, thrill_seeker, euphoria
5:15.396 aoe F immolate enemy2 48710.5/50000: 97% mana
3.2/5: 64% soul_shard
backdraft, thrill_seeker, euphoria
5:16.486 aoe I rain_of_fire Fluffy_Pillow 48505.5/50000: 97% mana
3.4/5: 68% soul_shard
backdraft, thrill_seeker(3), euphoria
5:17.575 aoe F immolate Fluffy_Pillow 49050.0/50000: 98% mana
0.5/5: 10% soul_shard
backdraft, thrill_seeker(3), euphoria
5:18.665 aoe L incinerate Fluffy_Pillow 48845.0/50000: 98% mana
0.7/5: 14% soul_shard
backdraft, thrill_seeker(4), euphoria
5:19.682 aoe J conflagrate Fluffy_Pillow 48353.5/50000: 97% mana
1.1/5: 22% soul_shard
thrill_seeker(4), euphoria
5:20.771 aoe L incinerate Fluffy_Pillow 48398.0/50000: 97% mana
1.9/5: 38% soul_shard
backdraft, thrill_seeker(5), euphoria

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_Nadjia"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=331586/infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_Nadjia_DD : 9889 dps, 5352 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9889.1 9889.1 17.3 / 0.175% 841.7 / 8.5% 20.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
418.3 414.7 Mana 0.00% 38.9 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Nadjia_DD 9889
Cataclysm 786 8.0% 9.7 32.36sec 24303 14583 Direct 29.2 6771 13558 8105 19.6%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.73 29.20 0.00 0.00 1.6666 0.0000 236522.68 236522.68 0.00% 14583.06 14583.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.40% 23.47 14 32 6771.08 6142 7478 6770.72 6577 6946 158929 158929 0.00%
crit 19.60% 5.72 0 16 13557.79 12283 14957 13521.93 0 14848 77594 77594 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.80
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1092) 0.0% (11.1%) 12.9 24.01sec 25435 9587

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.92 0.00 192.95 0.00 2.6531 0.1606 0.00 0.00 0.00% 9587.05 9587.05

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.91
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1092 11.1% 0.0 0.00sec 0 0 Direct 578.9 476 951 567 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 578.85 0.00 0.00 0.0000 0.0000 328500.18 328500.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 467.29 326 600 475.89 263 1005 475.94 451 497 222375 222375 0.00%
crit 19.27% 111.56 71 162 951.18 525 2011 951.66 833 1092 106125 106125 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1385 (1879) 14.0% (19.0%) 22.7 13.02sec 24853 12799 Direct 45.2 (89.8) 0 9207 9207 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.70 45.18 0.00 0.00 1.9418 0.0000 416036.17 416036.17 0.00% 12799.14 12799.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 45.18 32 58 9207.35 5869 12608 9207.50 8989 9445 416036 416036 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.77
  • if_expr:cast_time<havoc_remains
    Internal Combustion 494 5.0% 44.7 13.03sec 3317 0 Direct 44.7 2781 5554 3316 19.3%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.67 44.67 0.00 0.00 0.0000 0.0000 148137.03 148137.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 36.04 23 51 2780.56 1 3941 2781.92 2585 2995 100191 100191 0.00%
crit 19.32% 8.63 1 19 5553.90 17 7882 5570.36 2947 6821 47946 47946 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 841 8.5% 38.0 7.77sec 6648 5434 Direct 56.9 3728 7399 4438 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.01 56.93 0.00 0.00 1.2234 0.0000 252709.59 252709.59 0.00% 5434.26 5434.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 45.91 34 60 3728.37 2047 5193 3729.05 3468 3951 171176 171176 0.00%
crit 19.35% 11.01 3 20 7399.35 4094 10385 7408.47 5307 9121 81534 81534 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:19.10
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.90
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1668 16.9% 28.2 10.31sec 17777 14406 Direct 35.6 1556 3126 1850 18.6%
Periodic 357.1 1024 2047 1221 19.3% 95.9%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.23 35.58 357.12 357.12 1.2340 2.4237 501889.46 501889.46 0.00% 557.40 14405.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.36% 28.95 16 41 1556.11 819 2077 1556.18 1413 1684 45043 45043 0.00%
crit 18.64% 6.63 0 15 3126.41 1638 4155 3120.94 0 3848 20749 20749 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.73% 288.31 221 361 1023.74 0 1298 1023.84 1005 1048 295157 295157 0.00%
crit 19.27% 68.82 44 102 2047.38 1 2597 2048.27 1924 2155 140940 140940 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.74
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.56
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (235) 0.0% (2.4%) 4.7 64.76sec 15093 9658

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.68 0.00 0.00 0.00 1.5629 0.0000 0.00 0.00 0.00% 9657.64 9657.64

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.71
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 13.9 564 1127 676 19.9%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.92 0.00 0.00 0.0000 0.0000 9404.75 9404.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.15% 11.16 5 16 563.63 558 575 563.64 560 569 6290 6290 0.00%
crit 19.85% 2.76 0 8 1126.96 1116 1150 1093.08 0 1150 3115 3115 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 204 2.1% 0.0 0.00sec 0 0 Periodic 106.7 480 960 574 19.5% 18.2%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 106.69 106.69 0.0000 1.5419 61221.58 61221.58 0.00% 372.14 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.54% 85.93 64 114 480.35 38 503 480.37 458 491 41277 41277 0.00%
crit 19.46% 20.77 9 34 960.30 76 1006 960.72 834 995 19944 19944 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 616 6.3% 43.6 6.25sec 4262 2996 Direct 54.7 (54.7) 2846 5709 3394 19.1% (19.1%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.60 54.74 0.00 0.00 1.4225 0.0000 185812.17 185812.17 0.00% 2996.00 2996.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.86% 44.26 27 63 2846.17 1316 3529 2847.93 2625 3067 126004 126004 0.00%
crit 19.14% 10.48 2 22 5708.71 2784 7057 5705.91 4025 6659 59808 59808 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:32.26
    havoc
    [R]:11.62
  • if_expr:cast_time<havoc_remains
Rain of Fire 905 9.2% 17.2 16.53sec 15797 12877 Periodic 408.5 558 1117 666 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.23 0.00 0.00 408.55 1.2268 0.0000 272156.42 272156.42 0.00% 12877.05 12877.05
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.70% 329.70 232 459 558.38 507 617 558.41 552 570 184103 184103 0.00%
crit 19.30% 78.84 42 120 1116.78 1013 1234 1116.81 1094 1138 88054 88054 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.35
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.89
Soul Fire 527 5.3% 5.6 49.68sec 28494 8241 Direct 7.7 17292 34094 20513 19.2%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.56 7.71 0.00 0.00 3.4577 0.0000 158373.06 158373.06 0.00% 8240.87 8240.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 6.23 1 10 17292.06 8606 21810 17316.38 12946 21690 107706 107706 0.00%
crit 19.25% 1.48 0 6 34094.13 17259 43593 27235.56 0 43270 50667 50667 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.42
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.24
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.94sec 12051 10425 Direct 6.0 3382 6763 4018 18.8%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24102.99 24102.99 0.00% 10425.17 10425.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.21% 4.87 1 6 3381.62 3348 3449 3381.84 3348 3449 16476 16476 0.00%
crit 18.79% 1.13 0 5 6763.23 6696 6897 4856.03 0 6897 7627 7627 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3554 / 718
Immolation 3280 6.6% 39.0 5.50sec 5047 0 Direct 117.0 1409 2818 1682 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 196818.70 196818.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 94.31 79 106 1409.00 1395 1437 1409.00 1406 1412 132889 132889 0.00%
crit 19.39% 22.69 11 38 2818.03 2790 2874 2818.00 2796 2852 63930 63930 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 273 0.6% 41.0 5.26sec 400 279 Direct 41.0 335 671 400 19.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16410.30 23440.47 29.99% 278.59 278.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 33.06 26 40 335.32 335 335 335.32 335 335 11086 15835 29.99%
crit 19.36% 7.94 1 15 670.64 671 671 670.64 671 671 5324 7605 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 540 / 540
Firebolt 540 5.5% 95.5 3.15sec 1700 1188 Direct 94.8 1437 2874 1714 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.55 94.79 0.00 0.00 1.4308 0.0000 162455.39 162455.39 0.00% 1188.32 1188.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 76.52 49 98 1436.91 1437 1437 1436.91 1437 1437 109957 109957 0.00%
crit 19.27% 18.27 8 34 2873.82 2874 2874 2873.82 2874 2874 52499 52499 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:95.94
Simple Action Stats Execute Interval
Venthyr_Nadjia_DD
Havoc 9.7 32.23sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.67 0.00 0.00 0.00 1.2225 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.67
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 38.0 0.0 7.8sec 7.8sec 4.2sec 53.68% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:Venthyr_Nadjia_DD
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.1s
  • trigger_min/max:1.9s / 23.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:53.68%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia_DD
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Euphoria 3.4 0.0 78.0sec 78.0sec 9.9sec 11.19% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia_DD
  • cooldown name:buff_euphoria
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:78.0s / 78.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • euphoria_1:11.19%

Spelldata

  • id:331937
  • name:Euphoria
  • tooltip:Filled with the thrill of battle, increasing Haste by $w1%.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill Seeker 4.4 145.6 78.0sec 2.0sec 66.5sec 97.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_DD
  • cooldown name:buff_thrill_seeker
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 76.0s

Stack Uptimes

  • thrill_seeker_1:2.93%
  • thrill_seeker_3:2.92%
  • thrill_seeker_4:2.90%
  • thrill_seeker_5:2.87%
  • thrill_seeker_6:2.84%
  • thrill_seeker_7:2.82%
  • thrill_seeker_8:2.80%
  • thrill_seeker_9:2.78%
  • thrill_seeker_10:2.76%
  • thrill_seeker_11:2.74%
  • thrill_seeker_12:2.72%
  • thrill_seeker_13:2.69%
  • thrill_seeker_14:2.66%
  • thrill_seeker_15:2.63%
  • thrill_seeker_16:2.61%
  • thrill_seeker_17:2.59%
  • thrill_seeker_18:2.57%
  • thrill_seeker_19:2.55%
  • thrill_seeker_20:2.53%
  • thrill_seeker_21:2.51%
  • thrill_seeker_22:2.49%
  • thrill_seeker_23:2.47%
  • thrill_seeker_24:2.45%
  • thrill_seeker_25:2.43%
  • thrill_seeker_26:2.41%
  • thrill_seeker_27:2.40%
  • thrill_seeker_28:2.39%
  • thrill_seeker_29:2.38%
  • thrill_seeker_30:2.37%
  • thrill_seeker_31:2.36%
  • thrill_seeker_32:2.35%
  • thrill_seeker_33:2.34%
  • thrill_seeker_34:2.33%
  • thrill_seeker_35:2.31%
  • thrill_seeker_36:2.30%
  • thrill_seeker_37:2.30%
  • thrill_seeker_38:2.29%
  • thrill_seeker_39:2.27%

Spelldata

  • id:331939
  • name:Thrill Seeker
  • tooltip:At {$u=40} stacks, you will gain Euphoria.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
infernal - infernal: Embers 2.0 0.0 180.9sec 180.9sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_DD_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.4s
  • trigger_min/max:180.0s / 186.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.9sec 180.9sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_DD_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.4s
  • trigger_min/max:180.0s / 186.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.55% 7.13% 13.74% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Nadjia_DD
soul_fire Soul Shard 6.56 7.26 7.54% 1.11 0.51 6.51%
immolate Soul Shard 357.10 34.53 35.85% 0.10 1.18 3.32%
incinerate Soul Shard 43.63 11.02 11.45% 0.25 0.01 0.10%
conflagrate Soul Shard 38.01 28.46 29.55% 0.75 0.00 0.00%
mana_regen Mana 686.91 124836.49 100.00% 181.74 25344.06 16.88%
immolate_crits Soul Shard 34.56 3.34 3.47% 0.10 0.11 3.32%
incinerate_crits Soul Shard 10.48 1.05 1.09% 0.10 0.00 0.04%
infernal Soul Shard 120.00 10.65 11.06% 0.09 1.35 11.26%
pet - imp
energy_regen Energy 373.26 3649.94 100.00% 9.78 22.74 0.62%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 414.72 418.35 25375.4 48909.7 46598.0 50000.0
Soul Shard 4.0 0.32 0.32 3.2 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_Nadjia_DD
cataclysm Mana 9.7 4869.4 500.0 500.3 48.6
channel_demonfire Mana 12.9 9680.0 750.0 749.5 33.9
chaos_bolt Soul Shard 22.7 45.3 2.0 2.0 12443.9
conflagrate Mana 38.0 19003.1 500.0 499.9 13.3
havoc Mana 9.7 9670.3 1000.0 1000.5 0.0
immolate Mana 28.2 21148.1 750.0 749.1 23.7
impending_catastrophe Mana 4.7 9374.8 2000.0 2003.4 7.5
incinerate Mana 43.6 43628.3 1000.0 1000.6 4.3
rain_of_fire Soul Shard 17.2 51.7 3.0 3.0 5261.8
soul_fire Mana 6.6 6555.2 1000.0 1179.4 24.2
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 95.5 3821.3 40.0 40.0 42.5

Statistics & Data Analysis

Fight Length
Venthyr_Nadjia_DD Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
Venthyr_Nadjia_DD Damage Per Second
Count 627
Mean 9889.10
Minimum 9389.08
Maximum 10717.26
Spread ( max - min ) 1328.19
Range [ ( max - min ) / 2 * 100% ] 6.72%
Standard Deviation 220.9615
5th Percentile 9568.54
95th Percentile 10276.74
( 95th Percentile - 5th Percentile ) 708.19
Mean Distribution
Standard Deviation 8.8244
95.00% Confidence Interval ( 9871.80 - 9906.40 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1918
0.1 Scale Factor Error with Delta=300 417
0.05 Scale Factor Error with Delta=300 1668
0.01 Scale Factor Error with Delta=300 41679
Priority Target DPS
Venthyr_Nadjia_DD Priority Target Damage Per Second
Count 627
Mean 5352.16
Minimum 5046.44
Maximum 5871.17
Spread ( max - min ) 824.73
Range [ ( max - min ) / 2 * 100% ] 7.70%
Standard Deviation 131.1997
5th Percentile 5160.66
95th Percentile 5566.34
( 95th Percentile - 5th Percentile ) 405.68
Mean Distribution
Standard Deviation 5.2396
95.00% Confidence Interval ( 5341.89 - 5362.43 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2309
0.1 Scale Factor Error with Delta=300 147
0.05 Scale Factor Error with Delta=300 588
0.01 Scale Factor Error with Delta=300 14695
DPS(e)
Venthyr_Nadjia_DD Damage Per Second (Effective)
Count 627
Mean 9889.10
Minimum 9389.08
Maximum 10717.26
Spread ( max - min ) 1328.19
Range [ ( max - min ) / 2 * 100% ] 6.72%
Damage
Venthyr_Nadjia_DD Damage
Count 627
Mean 2594866.09
Minimum 2049482.87
Maximum 3120907.59
Spread ( max - min ) 1071424.72
Range [ ( max - min ) / 2 * 100% ] 20.65%
DTPS
Venthyr_Nadjia_DD Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Nadjia_DD Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Nadjia_DD Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Nadjia_DD Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Nadjia_DD Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Nadjia_DD Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_Nadjia_DDTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Nadjia_DD Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.42 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.80 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.35 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.91 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.74 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.67 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.89 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 19.10 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.71 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 32.26 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.90 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.24 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.56 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.77 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.62 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFDFFKLJLDJLALIEHRNQRNOPFFIJEILJLALJHQRQPRNELIFJKLLJLI9AEHNQRNPQLLJIFLEFJLLAIHRNQRPNR9EFIJIKLJLLAHQRNQRPNEILLFMJLDFLJA9EHQNQNPQDFLJKEFLAIJLHRNQPRQRE9FFFIJLJALHNQQRNPEILJFKLLJILLAHNOQQNELIFFFJLLLJ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.742 aoe E channel_demonfire Fluffy_Pillow 49371.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.970 cds M summon_infernal Fluffy_Pillow 49735.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust, thrill_seeker
0:04.975 aoe H havoc enemy2 49237.5/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust, thrill_seeker(3)
0:05.983 havoc Q chaos_bolt Fluffy_Pillow 48741.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust, thrill_seeker(3)
0:07.992 havoc N conflagrate Fluffy_Pillow 49746.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(4)
0:09.000 havoc Q chaos_bolt Fluffy_Pillow 49750.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, thrill_seeker(5)
0:10.409 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, thrill_seeker(6)
0:11.417 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft, thrill_seeker(6)
0:12.423 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, thrill_seeker(7)
0:13.830 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(7)
0:14.837 havoc Q chaos_bolt Fluffy_Pillow 49959.0/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft, thrill_seeker(8)
0:16.242 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust, thrill_seeker(9)
0:17.247 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, thrill_seeker(9)
0:18.253 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
bloodlust, backdraft, thrill_seeker(10)
0:20.638 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust, backdraft, thrill_seeker(11)
0:21.646 aoe D rain_of_fire Fluffy_Pillow 49253.0/50000: 99% mana
3.1/5: 62% soul_shard
bloodlust, backdraft, thrill_seeker(11)
0:22.653 aoe F immolate enemy2 49756.5/50000: 100% mana
0.4/5: 8% soul_shard
bloodlust, backdraft, thrill_seeker(12)
0:23.660 aoe F immolate enemy3 49252.5/50000: 99% mana
0.6/5: 12% soul_shard
bloodlust, backdraft, thrill_seeker(12)
0:24.666 aoe K impending_catastrophe Fluffy_Pillow 49005.5/50000: 98% mana
0.9/5: 18% soul_shard
bloodlust, backdraft, thrill_seeker(13)
0:26.008 aoe L incinerate Fluffy_Pillow 47676.5/50000: 95% mana
1.4/5: 28% soul_shard
bloodlust, backdraft, thrill_seeker(14)
0:26.947 aoe J conflagrate Fluffy_Pillow 47146.0/50000: 94% mana
1.8/5: 36% soul_shard
bloodlust, thrill_seeker(14)
0:27.953 aoe L incinerate Fluffy_Pillow 47149.0/50000: 94% mana
2.8/5: 56% soul_shard
bloodlust, backdraft, thrill_seeker(14)
0:28.893 aoe D rain_of_fire Fluffy_Pillow 46619.0/50000: 93% mana
3.3/5: 66% soul_shard
bloodlust, thrill_seeker(15)
0:29.900 aoe J conflagrate Fluffy_Pillow 47122.5/50000: 94% mana
0.7/5: 14% soul_shard
bloodlust, thrill_seeker(15)
0:30.906 aoe L incinerate Fluffy_Pillow 47125.5/50000: 94% mana
1.5/5: 30% soul_shard
bloodlust, backdraft, thrill_seeker(16)
0:31.846 default A cataclysm Fluffy_Pillow 46595.5/50000: 93% mana
2.1/5: 42% soul_shard
bloodlust, thrill_seeker(16)
0:33.187 aoe L incinerate Fluffy_Pillow 46766.0/50000: 94% mana
2.5/5: 50% soul_shard
bloodlust, thrill_seeker(17)
0:34.528 aoe I rain_of_fire Fluffy_Pillow 46436.5/50000: 93% mana
3.1/5: 62% soul_shard
bloodlust, thrill_seeker(18)
0:35.534 aoe E channel_demonfire Fluffy_Pillow 46939.5/50000: 94% mana
0.2/5: 4% soul_shard
bloodlust, thrill_seeker(18)
0:37.766 aoe H havoc enemy2 47305.5/50000: 95% mana
0.7/5: 14% soul_shard
bloodlust, thrill_seeker(19)
0:38.771 havoc R incinerate Fluffy_Pillow 46808.0/50000: 94% mana
0.8/5: 16% soul_shard
bloodlust, thrill_seeker(20)
0:40.112 havoc N conflagrate Fluffy_Pillow 46478.5/50000: 93% mana
1.4/5: 28% soul_shard
bloodlust, thrill_seeker(21)
0:41.118 havoc Q chaos_bolt Fluffy_Pillow 46481.5/50000: 93% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(21)
0:42.946 havoc R incinerate Fluffy_Pillow 47395.5/50000: 95% mana
1.0/5: 20% soul_shard
thrill_seeker(22)
0:44.685 havoc N conflagrate Fluffy_Pillow 47265.0/50000: 95% mana
1.6/5: 32% soul_shard
thrill_seeker(23)
0:45.991 havoc O soul_fire Fluffy_Pillow 47418.0/50000: 95% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(23)
0:49.468 havoc P immolate Fluffy_Pillow 48156.5/50000: 96% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(25)
0:50.774 aoe F immolate enemy2 48059.5/50000: 96% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(26)
0:52.080 aoe F immolate enemy3 47962.5/50000: 96% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(27)
0:53.390 aoe I rain_of_fire Fluffy_Pillow 47867.5/50000: 96% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(27)
0:54.698 aoe J conflagrate Fluffy_Pillow 48521.5/50000: 97% mana
2.0/5: 40% soul_shard
thrill_seeker(28)
0:56.003 aoe E channel_demonfire Fluffy_Pillow 48674.0/50000: 97% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(29)
0:58.736 aoe I rain_of_fire Fluffy_Pillow 49290.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft, thrill_seeker(30)
1:00.043 aoe L incinerate Fluffy_Pillow 49944.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft, thrill_seeker(31)
1:01.264 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
0.6/5: 12% soul_shard
thrill_seeker(31)
1:02.570 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft, thrill_seeker(32)
1:03.789 default A cataclysm Fluffy_Pillow 48765.5/50000: 98% mana
1.7/5: 34% soul_shard
thrill_seeker(32)
1:05.530 aoe L incinerate Fluffy_Pillow 49136.0/50000: 98% mana
1.9/5: 38% soul_shard
thrill_seeker(33)
1:07.269 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
2.2/5: 44% soul_shard
thrill_seeker(34)
1:08.590 aoe H havoc enemy2 49162.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, thrill_seeker(35)
1:09.895 havoc Q chaos_bolt Fluffy_Pillow 48814.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, thrill_seeker(35)
1:11.721 havoc R incinerate Fluffy_Pillow 49727.5/50000: 99% mana
1.4/5: 28% soul_shard
thrill_seeker(36)
1:13.461 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(37)
1:16.071 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
thrill_seeker(39)
1:17.377 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
thrill_seeker(39)
1:19.118 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
euphoria
1:20.205 aoe E channel_demonfire Fluffy_Pillow 49046.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker, euphoria
1:22.594 aoe L incinerate Fluffy_Pillow 49490.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft, thrill_seeker(3), euphoria
1:23.609 aoe I rain_of_fire Fluffy_Pillow 48998.0/50000: 98% mana
3.3/5: 66% soul_shard
thrill_seeker(3), euphoria
1:24.698 aoe F immolate enemy3 49542.5/50000: 99% mana
0.4/5: 8% soul_shard
thrill_seeker(4), euphoria
1:25.787 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
0.6/5: 12% soul_shard
thrill_seeker(4), euphoria
1:26.878 aoe K impending_catastrophe Fluffy_Pillow 49297.5/50000: 99% mana
1.2/5: 24% soul_shard
backdraft, thrill_seeker(5), euphoria
1:28.330 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
1.4/5: 28% soul_shard
backdraft, thrill_seeker(6)
1:29.550 aoe L incinerate Fluffy_Pillow 47612.5/50000: 95% mana
1.8/5: 36% soul_shard
thrill_seeker(6)
1:31.290 aoe J conflagrate Fluffy_Pillow 47482.5/50000: 95% mana
2.1/5: 42% soul_shard
thrill_seeker(7)
1:32.596 aoe L incinerate Fluffy_Pillow 47635.5/50000: 95% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(8)
1:33.815 aoe I rain_of_fire Fluffy_Pillow 47245.0/50000: 94% mana
3.1/5: 62% soul_shard
thrill_seeker(8)
1:35.124 default 9 soul_fire Fluffy_Pillow 47899.5/50000: 96% mana
0.3/5: 6% soul_shard
thrill_seeker(9)
1:38.599 default A cataclysm Fluffy_Pillow 48637.0/50000: 97% mana
1.8/5: 36% soul_shard
thrill_seeker(11)
1:40.340 aoe E channel_demonfire Fluffy_Pillow 49007.5/50000: 98% mana
1.8/5: 36% soul_shard
thrill_seeker(12)
1:43.165 aoe H havoc enemy2 49670.0/50000: 99% mana
2.2/5: 44% soul_shard
thrill_seeker(13)
1:44.472 havoc N conflagrate Fluffy_Pillow 49323.5/50000: 99% mana
2.2/5: 44% soul_shard
thrill_seeker(14)
1:45.779 havoc Q chaos_bolt Fluffy_Pillow 49477.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft, thrill_seeker(14)
1:47.607 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
thrill_seeker(15)
1:49.348 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
thrill_seeker(16)
1:50.654 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, thrill_seeker(17)
1:51.961 havoc Q chaos_bolt Fluffy_Pillow 49059.0/50000: 98% mana
3.7/5: 74% soul_shard
backdraft, thrill_seeker(17)
1:53.788 aoe L incinerate Fluffy_Pillow 49972.5/50000: 100% mana
2.1/5: 42% soul_shard
thrill_seeker(18)
1:55.531 aoe L incinerate Fluffy_Pillow 49003.5/50000: 98% mana
2.3/5: 46% soul_shard
thrill_seeker(19)
1:57.272 aoe J conflagrate Fluffy_Pillow 48874.0/50000: 98% mana
2.8/5: 56% soul_shard
thrill_seeker(20)
1:58.580 aoe I rain_of_fire Fluffy_Pillow 49028.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft, thrill_seeker(21)
1:59.887 aoe F immolate enemy3 49681.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft, thrill_seeker(21)
2:01.193 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft, thrill_seeker(22)
2:02.412 aoe E channel_demonfire Fluffy_Pillow 48861.5/50000: 98% mana
1.3/5: 26% soul_shard
thrill_seeker(23)
2:05.209 aoe F immolate enemy2 49510.0/50000: 99% mana
1.6/5: 32% soul_shard
thrill_seeker(24)
2:06.514 aoe J conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
1.9/5: 38% soul_shard
thrill_seeker(25)
2:07.821 aoe L incinerate Fluffy_Pillow 49405.0/50000: 99% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(25)
2:09.040 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
thrill_seeker(26)
2:10.780 default A cataclysm Fluffy_Pillow 48872.0/50000: 98% mana
3.2/5: 64% soul_shard
thrill_seeker(27)
2:12.521 aoe I rain_of_fire Fluffy_Pillow 49242.5/50000: 98% mana
3.4/5: 68% soul_shard
thrill_seeker(28)
2:13.827 aoe H havoc enemy2 49895.5/50000: 100% mana
0.4/5: 8% soul_shard
thrill_seeker(28)
2:15.134 havoc R incinerate Fluffy_Pillow 49549.0/50000: 99% mana
0.7/5: 14% soul_shard
thrill_seeker(29)
2:16.876 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.1/5: 22% soul_shard
thrill_seeker(30)
2:18.182 havoc Q chaos_bolt Fluffy_Pillow 49156.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(31)
2:20.010 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
thrill_seeker(32)
2:21.752 havoc P immolate Fluffy_Pillow 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
thrill_seeker(32)
2:23.058 havoc N conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
1.5/5: 30% soul_shard
thrill_seeker(33)
2:24.428 havoc R incinerate Fluffy_Pillow 49091.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(34)
2:25.648 default 9 soul_fire Fluffy_Pillow 48701.0/50000: 97% mana
3.3/5: 66% soul_shard
thrill_seeker(34)
2:29.126 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
4.7/5: 94% soul_shard
thrill_seeker(36)
2:32.046 aoe F immolate enemy3 49712.5/50000: 99% mana
5.0/5: 100% soul_shard
thrill_seeker(38)
2:33.352 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
5.0/5: 100% soul_shard
thrill_seeker(38)
2:34.657 aoe J conflagrate Fluffy_Pillow 49904.5/50000: 100% mana
2.1/5: 42% soul_shard
thrill_seeker(39)
2:35.964 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft, thrill_seeker(39)
2:37.270 aoe K impending_catastrophe Fluffy_Pillow 50000.0/50000: 100% mana
0.0/5: 0% soul_shard
backdraft, euphoria
2:38.722 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
0.3/5: 6% soul_shard
backdraft, thrill_seeker, euphoria
2:39.738 aoe J conflagrate Fluffy_Pillow 47510.5/50000: 95% mana
0.5/5: 10% soul_shard
thrill_seeker, euphoria
2:40.827 aoe L incinerate Fluffy_Pillow 47555.0/50000: 95% mana
1.3/5: 26% soul_shard
backdraft, thrill_seeker(3), euphoria
2:41.843 aoe L incinerate Fluffy_Pillow 47063.0/50000: 94% mana
1.5/5: 30% soul_shard
thrill_seeker(3), euphoria
2:43.294 default A cataclysm Fluffy_Pillow 46788.5/50000: 94% mana
2.0/5: 40% soul_shard
thrill_seeker(4), euphoria
2:44.746 aoe H havoc enemy2 47014.5/50000: 94% mana
2.3/5: 46% soul_shard
thrill_seeker(5), euphoria
2:45.835 havoc Q chaos_bolt Fluffy_Pillow 46559.0/50000: 93% mana
2.4/5: 48% soul_shard
thrill_seeker(5), euphoria
2:48.010 havoc R incinerate Fluffy_Pillow 47646.5/50000: 95% mana
0.7/5: 14% soul_shard
thrill_seeker(7)
2:49.752 havoc N conflagrate Fluffy_Pillow 47517.5/50000: 95% mana
1.4/5: 28% soul_shard
thrill_seeker(7)
2:51.060 havoc Q chaos_bolt Fluffy_Pillow 47671.5/50000: 95% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(8)
2:52.887 havoc R incinerate Fluffy_Pillow 48585.0/50000: 97% mana
0.9/5: 18% soul_shard
thrill_seeker(9)
2:54.627 havoc P immolate Fluffy_Pillow 48455.0/50000: 97% mana
1.5/5: 30% soul_shard
thrill_seeker(10)
2:55.932 havoc N conflagrate Fluffy_Pillow 48357.5/50000: 97% mana
1.6/5: 32% soul_shard
thrill_seeker(10)
2:57.239 aoe E channel_demonfire Fluffy_Pillow 48511.0/50000: 97% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(11)
3:00.065 aoe I rain_of_fire Fluffy_Pillow 49174.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft, thrill_seeker(13)
3:01.372 aoe L incinerate Fluffy_Pillow 49827.5/50000: 100% mana
0.3/5: 6% soul_shard
backdraft, thrill_seeker(13)
3:02.593 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
0.6/5: 12% soul_shard
thrill_seeker(14)
3:04.334 aoe F immolate enemy3 48873.5/50000: 98% mana
1.0/5: 20% soul_shard
thrill_seeker(15)
3:05.639 cds M summon_infernal Fluffy_Pillow 48776.0/50000: 98% mana
1.2/5: 24% soul_shard
thrill_seeker(15)
3:06.945 aoe J conflagrate Fluffy_Pillow 48429.0/50000: 97% mana
1.5/5: 30% soul_shard
thrill_seeker(16)
3:08.250 aoe L incinerate Fluffy_Pillow 48581.5/50000: 97% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(17)
3:09.470 aoe D rain_of_fire Fluffy_Pillow 48191.5/50000: 96% mana
3.0/5: 60% soul_shard
thrill_seeker(17)
3:10.775 aoe F immolate enemy2 48844.0/50000: 98% mana
0.5/5: 10% soul_shard
thrill_seeker(18)
3:12.082 aoe L incinerate Fluffy_Pillow 48747.5/50000: 97% mana
0.8/5: 16% soul_shard
thrill_seeker(19)
3:13.823 aoe J conflagrate Fluffy_Pillow 48618.0/50000: 97% mana
1.7/5: 34% soul_shard
thrill_seeker(19)
3:15.130 default A cataclysm Fluffy_Pillow 48771.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, thrill_seeker(20)
3:16.870 default 9 soul_fire Fluffy_Pillow 49141.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, thrill_seeker(21)
3:20.348 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(23)
3:23.174 aoe H havoc enemy2 49665.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(24)
3:24.481 havoc Q chaos_bolt Fluffy_Pillow 49319.0/50000: 99% mana
5.0/5: 100% soul_shard
thrill_seeker(25)
3:27.090 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(26)
3:28.396 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.7/5: 94% soul_shard
backdraft, thrill_seeker(27)
3:30.225 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(28)
3:31.617 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft, thrill_seeker(28)
3:32.922 havoc Q chaos_bolt Fluffy_Pillow 49251.5/50000: 99% mana
4.7/5: 94% soul_shard
backdraft, thrill_seeker(29)
3:34.749 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(30)
3:36.056 aoe F immolate enemy3 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
thrill_seeker(31)
3:37.362 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.5/5: 10% soul_shard
thrill_seeker(31)
3:39.102 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
thrill_seeker(32)
3:40.409 aoe K impending_catastrophe Fluffy_Pillow 49155.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft, thrill_seeker(33)
3:42.149 aoe E channel_demonfire Fluffy_Pillow 48002.0/50000: 96% mana
1.8/5: 36% soul_shard
backdraft, thrill_seeker(34)
3:45.012 aoe F immolate enemy2 48683.5/50000: 97% mana
2.1/5: 42% soul_shard
backdraft, thrill_seeker(35)
3:46.318 aoe L incinerate Fluffy_Pillow 48586.5/50000: 97% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(36)
3:47.538 default A cataclysm Fluffy_Pillow 48196.5/50000: 96% mana
2.6/5: 52% soul_shard
thrill_seeker(36)
3:49.280 aoe I rain_of_fire Fluffy_Pillow 48567.5/50000: 97% mana
3.0/5: 60% soul_shard
thrill_seeker(37)
3:50.587 aoe J conflagrate Fluffy_Pillow 49221.0/50000: 98% mana
0.0/5: 0% soul_shard
thrill_seeker(38)
3:51.894 aoe L incinerate Fluffy_Pillow 49374.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft, thrill_seeker(38)
3:53.115 aoe H havoc enemy2 48985.0/50000: 98% mana
1.0/5: 20% soul_shard
thrill_seeker(39)
3:54.482 havoc R incinerate Fluffy_Pillow 48668.5/50000: 97% mana
1.2/5: 24% soul_shard
euphoria
3:55.934 havoc N conflagrate Fluffy_Pillow 48394.5/50000: 97% mana
1.7/5: 34% soul_shard
euphoria
3:57.023 havoc Q chaos_bolt Fluffy_Pillow 48439.0/50000: 97% mana
3.0/5: 60% soul_shard
backdraft, thrill_seeker, euphoria
3:58.545 havoc P immolate Fluffy_Pillow 49200.0/50000: 98% mana
1.4/5: 28% soul_shard
thrill_seeker(3), euphoria
3:59.636 havoc R incinerate Fluffy_Pillow 48995.5/50000: 98% mana
1.5/5: 30% soul_shard
thrill_seeker(3), euphoria
4:01.089 havoc Q chaos_bolt Fluffy_Pillow 48722.0/50000: 97% mana
2.2/5: 44% soul_shard
thrill_seeker(4), euphoria
4:03.265 havoc R incinerate Fluffy_Pillow 49810.0/50000: 100% mana
0.5/5: 10% soul_shard
thrill_seeker(5), euphoria
4:04.716 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
thrill_seeker(6)
4:07.600 default 9 soul_fire Fluffy_Pillow 49694.0/50000: 99% mana
1.4/5: 28% soul_shard
thrill_seeker(7)
4:11.078 aoe F immolate enemy2 49002.5/50000: 98% mana
3.0/5: 60% soul_shard
thrill_seeker(9)
4:12.384 aoe F immolate Fluffy_Pillow 48905.5/50000: 98% mana
3.0/5: 60% soul_shard
thrill_seeker(10)
4:13.691 aoe F immolate enemy3 48809.0/50000: 98% mana
3.4/5: 68% soul_shard
thrill_seeker(10)
4:14.995 aoe I rain_of_fire Fluffy_Pillow 48711.0/50000: 97% mana
3.4/5: 68% soul_shard
thrill_seeker(11)
4:16.301 aoe J conflagrate Fluffy_Pillow 49364.0/50000: 99% mana
0.6/5: 12% soul_shard
thrill_seeker(12)
4:17.607 aoe L incinerate Fluffy_Pillow 49517.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft, thrill_seeker(12)
4:18.826 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
thrill_seeker(13)
4:20.133 default A cataclysm Fluffy_Pillow 49155.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, thrill_seeker(14)
4:21.873 aoe L incinerate Fluffy_Pillow 49502.0/50000: 99% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(14)
4:23.092 aoe H havoc enemy2 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
thrill_seeker(15)
4:24.481 havoc N conflagrate Fluffy_Pillow 48696.5/50000: 97% mana
2.9/5: 58% soul_shard
thrill_seeker(16)
4:25.787 havoc Q chaos_bolt Fluffy_Pillow 48849.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft, thrill_seeker(16)
4:27.615 havoc Q chaos_bolt Fluffy_Pillow 49763.5/50000: 100% mana
2.2/5: 44% soul_shard
thrill_seeker(17)
4:30.224 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
thrill_seeker(19)
4:31.964 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
thrill_seeker(19)
4:33.269 havoc P immolate Fluffy_Pillow 49154.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(20)
4:34.577 aoe E channel_demonfire Fluffy_Pillow 49058.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(21)
4:37.445 aoe I rain_of_fire Fluffy_Pillow 49742.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft, thrill_seeker(22)
4:38.751 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft, thrill_seeker(23)
4:39.969 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
0.6/5: 12% soul_shard
thrill_seeker(23)
4:41.276 aoe F immolate enemy3 49155.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft, thrill_seeker(24)
4:42.582 aoe K impending_catastrophe Fluffy_Pillow 49058.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft, thrill_seeker(25)
4:44.323 aoe L incinerate Fluffy_Pillow 47928.5/50000: 96% mana
1.9/5: 38% soul_shard
backdraft, thrill_seeker(26)
4:45.541 aoe L incinerate Fluffy_Pillow 47537.5/50000: 95% mana
2.2/5: 44% soul_shard
thrill_seeker(26)
4:47.282 aoe J conflagrate Fluffy_Pillow 47408.0/50000: 95% mana
2.9/5: 58% soul_shard
thrill_seeker(27)
4:48.589 aoe I rain_of_fire Fluffy_Pillow 47561.5/50000: 95% mana
3.4/5: 68% soul_shard
backdraft, thrill_seeker(28)
4:49.897 aoe L incinerate Fluffy_Pillow 48215.5/50000: 96% mana
0.7/5: 14% soul_shard
backdraft, thrill_seeker(28)
4:51.116 aoe L incinerate Fluffy_Pillow 47825.0/50000: 96% mana
0.9/5: 18% soul_shard
thrill_seeker(29)
4:52.855 default A cataclysm Fluffy_Pillow 47694.5/50000: 95% mana
1.4/5: 28% soul_shard
thrill_seeker(30)
4:54.596 aoe H havoc enemy2 48065.0/50000: 96% mana
1.7/5: 34% soul_shard
thrill_seeker(31)
4:55.903 havoc N conflagrate Fluffy_Pillow 47718.5/50000: 95% mana
1.7/5: 34% soul_shard
thrill_seeker(31)
4:57.209 havoc O soul_fire Fluffy_Pillow 47871.5/50000: 96% mana
3.0/5: 60% soul_shard
backdraft, thrill_seeker(32)
5:00.686 havoc Q chaos_bolt Fluffy_Pillow 48610.0/50000: 97% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(34)
5:02.513 havoc Q chaos_bolt Fluffy_Pillow 49523.5/50000: 99% mana
3.0/5: 60% soul_shard
thrill_seeker(35)
5:05.122 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
thrill_seeker(36)
5:06.426 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(37)
5:09.342 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(38)
5:10.561 aoe I rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.3/5: 66% soul_shard
thrill_seeker(39)
5:11.868 aoe F immolate Fluffy_Pillow 49655.5/50000: 99% mana
0.3/5: 6% soul_shard
thrill_seeker(39)
5:13.175 aoe F immolate enemy3 49252.5/50000: 99% mana
0.7/5: 14% soul_shard
euphoria
5:14.264 aoe F immolate enemy2 49047.0/50000: 98% mana
0.7/5: 14% soul_shard
thrill_seeker, euphoria
5:15.354 aoe J conflagrate Fluffy_Pillow 48842.0/50000: 98% mana
1.1/5: 22% soul_shard
thrill_seeker, euphoria
5:16.444 aoe L incinerate Fluffy_Pillow 48887.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft, thrill_seeker(3), euphoria
5:17.460 aoe L incinerate Fluffy_Pillow 48395.0/50000: 97% mana
2.1/5: 42% soul_shard
thrill_seeker(3), euphoria
5:18.912 aoe L incinerate Fluffy_Pillow 48121.0/50000: 96% mana
2.4/5: 48% soul_shard
thrill_seeker(4), euphoria
5:20.362 aoe J conflagrate Fluffy_Pillow 47846.0/50000: 96% mana
2.9/5: 58% soul_shard
thrill_seeker(5), euphoria

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_Nadjia_DD"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=331584/331586/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_Nadjia_Prep : 9734 dps, 5198 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9734.2 9734.2 17.5 / 0.180% 844.5 / 8.7% 20.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
418.2 414.6 Mana 0.00% 38.9 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Nadjia_Prep 9734
Cataclysm 779 8.0% 9.7 32.41sec 24039 14419 Direct 29.2 6704 13410 8014 19.5%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.74 29.23 0.00 0.00 1.6672 0.0000 234258.90 234258.90 0.00% 14419.48 14419.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.47% 23.53 14 32 6703.57 6141 7261 6703.15 6503 6874 157709 157709 0.00%
crit 19.53% 5.71 0 13 13410.41 12283 14521 13383.83 0 14519 76550 76550 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.80
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1084) 0.0% (11.1%) 12.9 24.07sec 25160 9481

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.95 0.00 193.45 0.00 2.6538 0.1607 0.00 0.00 0.00% 9481.09 9481.09

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.95
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1084 11.1% 0.0 0.00sec 0 0 Direct 580.3 471 941 561 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 580.35 0.00 0.00 0.0000 0.0000 325760.68 325760.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 468.48 323 604 470.58 263 976 470.66 442 501 220477 220477 0.00%
crit 19.28% 111.87 68 158 941.36 525 1952 941.14 789 1069 105283 105283 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1362 (1840) 14.0% (18.9%) 22.8 12.83sec 24286 12509 Direct 45.3 (90.0) 0 9031 9031 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.75 45.28 0.00 0.00 1.9415 0.0000 408928.31 408928.31 0.00% 12509.26 12509.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 45.28 32 60 9031.46 5861 12241 9031.17 8822 9262 408928 408928 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.84
  • if_expr:cast_time<havoc_remains
    Internal Combustion 479 4.9% 44.8 12.80sec 3209 0 Direct 44.8 2695 5370 3208 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.77 44.77 0.00 0.00 0.0000 0.0000 143643.33 143643.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 36.17 22 49 2694.81 1 3715 2696.55 2467 2893 97473 97473 0.00%
crit 19.21% 8.60 1 19 5369.62 12 7430 5365.92 4007 6645 46171 46171 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 823 8.5% 38.0 7.79sec 6509 5320 Direct 56.8 3640 7270 4351 19.6%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.99 56.83 0.00 0.00 1.2234 0.0000 247240.58 247240.58 0.00% 5320.21 5320.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.42% 45.71 30 59 3639.84 2047 5042 3641.15 3424 3995 166383 166383 0.00%
crit 19.58% 11.13 1 21 7269.54 4095 10084 7264.87 5045 9439 80857 80857 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:19.12
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.86
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1653 17.0% 28.2 10.26sec 17635 14286 Direct 35.7 1538 3065 1841 19.9%
Periodic 357.2 1012 2027 1208 19.3% 95.9%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.20 35.70 357.23 357.23 1.2345 2.4234 497338.40 497338.40 0.00% 552.27 14285.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.13% 28.61 17 42 1537.81 819 2017 1537.78 1404 1645 44005 44005 0.00%
crit 19.87% 7.09 0 16 3064.92 1638 4033 3060.51 0 4033 21712 21712 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.68% 288.22 220 363 1012.21 0 1261 1012.27 991 1030 291741 291741 0.00%
crit 19.32% 69.01 42 107 2026.69 10 2521 2027.00 1895 2125 139881 139881 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.70
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.60
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (232) 0.0% (2.4%) 4.7 64.93sec 14926 9547

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 1.5635 0.0000 0.00 0.00 0.00% 9547.19 9547.19

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.70
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 13.9 558 1116 665 19.0%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.89 0.00 0.00 0.0000 0.0000 9224.73 9224.73 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.03% 11.26 6 17 558.02 558 558 558.02 558 558 6282 6282 0.00%
crit 18.97% 2.64 0 8 1116.04 1116 1116 1050.19 0 1116 2942 2942 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 201 2.1% 0.0 0.00sec 0 0 Periodic 106.5 476 951 568 19.3% 18.2%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 106.50 106.50 0.0000 1.5438 60479.28 60479.28 0.00% 367.86 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 85.91 65 112 476.09 38 488 476.08 454 486 40897 40897 0.00%
crit 19.33% 20.59 8 33 951.30 76 977 951.02 821 977 19582 19582 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 602 6.2% 43.6 6.29sec 4169 2932 Direct 54.8 (54.8) 2769 5564 3314 19.5% (19.5%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.57 54.81 0.00 0.00 1.4222 0.0000 181637.32 181637.32 0.00% 2931.53 2931.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.51% 44.13 26 69 2768.74 1317 3426 2771.14 2549 2987 122222 122222 0.00%
crit 19.49% 10.68 2 21 5564.28 2654 6852 5569.11 4496 6734 59415 59415 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:32.15
    havoc
    [R]:11.64
  • if_expr:cast_time<havoc_remains
Rain of Fire 895 9.2% 17.2 16.82sec 15644 12761 Periodic 407.4 553 1106 660 19.4% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.20 0.00 0.00 407.41 1.2260 0.0000 269049.83 269049.83 0.00% 12760.85 12760.85
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.56% 328.20 229 455 552.96 507 599 552.92 546 558 181478 181478 0.00%
crit 19.44% 79.21 47 121 1105.66 1013 1198 1105.56 1085 1128 87572 87572 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.31
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.89
Soul Fire 513 5.3% 5.6 49.56sec 27731 8026 Direct 7.7 16902 33990 20149 19.1%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.57 7.66 0.00 0.00 3.4551 0.0000 154398.93 154398.93 0.00% 8026.14 8026.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.93% 6.20 2 10 16902.46 8599 21176 16904.15 12811 19874 104748 104748 0.00%
crit 19.07% 1.46 0 5 33989.55 17244 42348 26051.62 0 42187 49651 49651 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.50
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.15
  • if_expr:cast_time<havoc_remains
Summon Infernal 80 0.8% 2.0 180.75sec 11919 10310 Direct 6.0 3348 6696 3970 18.7%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23837.44 23837.44 0.00% 10310.31 10310.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.34% 4.88 1 6 3348.13 3348 3348 3348.13 3348 3348 16340 16340 0.00%
crit 18.66% 1.12 0 5 6696.27 6696 6696 4827.30 0 6696 7497 7497 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3509 / 709
Immolation 3244 6.7% 39.0 5.50sec 4990 0 Direct 117.0 1395 2790 1663 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194622.58 194622.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 94.49 81 105 1395.06 1395 1395 1395.06 1395 1395 131821 131821 0.00%
crit 19.24% 22.51 12 36 2790.11 2790 2790 2790.11 2790 2790 62802 62802 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.26sec 388 270 Direct 41.0 326 651 388 19.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15918.83 22738.45 29.99% 270.25 270.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 33.10 24 40 325.55 326 326 325.55 326 326 10776 15393 29.99%
crit 19.26% 7.90 1 17 651.10 651 651 651.10 651 651 5142 7345 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 524 / 524
Firebolt 524 5.4% 95.5 3.15sec 1650 1153 Direct 94.8 1395 2790 1664 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.55 94.79 0.00 0.00 1.4308 0.0000 157692.53 157692.53 0.00% 1153.48 1153.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 76.55 57 100 1395.06 1395 1395 1395.06 1395 1395 106785 106785 0.00%
crit 19.25% 18.25 8 32 2790.11 2790 2790 2790.11 2790 2790 50907 50907 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:95.94
Simple Action Stats Execute Interval
Venthyr_Nadjia_Prep
Havoc 9.7 32.31sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.66 0.00 0.00 0.00 1.2225 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.66
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 38.0 0.0 7.8sec 7.8sec 4.2sec 53.55% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia_Prep
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.0s
  • trigger_min/max:1.9s / 23.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:53.55%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia_Prep
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Euphoria 3.4 0.0 78.0sec 78.0sec 9.9sec 11.19% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia_Prep
  • cooldown name:buff_euphoria
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:78.0s / 78.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • euphoria_1:11.19%

Spelldata

  • id:331937
  • name:Euphoria
  • tooltip:Filled with the thrill of battle, increasing Haste by $w1%.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill Seeker 4.4 145.6 78.0sec 2.0sec 66.5sec 97.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_Prep
  • cooldown name:buff_thrill_seeker
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 76.0s

Stack Uptimes

  • thrill_seeker_1:2.93%
  • thrill_seeker_3:2.92%
  • thrill_seeker_4:2.90%
  • thrill_seeker_5:2.87%
  • thrill_seeker_6:2.84%
  • thrill_seeker_7:2.82%
  • thrill_seeker_8:2.80%
  • thrill_seeker_9:2.78%
  • thrill_seeker_10:2.76%
  • thrill_seeker_11:2.74%
  • thrill_seeker_12:2.72%
  • thrill_seeker_13:2.69%
  • thrill_seeker_14:2.66%
  • thrill_seeker_15:2.63%
  • thrill_seeker_16:2.61%
  • thrill_seeker_17:2.59%
  • thrill_seeker_18:2.57%
  • thrill_seeker_19:2.55%
  • thrill_seeker_20:2.53%
  • thrill_seeker_21:2.51%
  • thrill_seeker_22:2.49%
  • thrill_seeker_23:2.47%
  • thrill_seeker_24:2.45%
  • thrill_seeker_25:2.43%
  • thrill_seeker_26:2.41%
  • thrill_seeker_27:2.40%
  • thrill_seeker_28:2.39%
  • thrill_seeker_29:2.38%
  • thrill_seeker_30:2.37%
  • thrill_seeker_31:2.36%
  • thrill_seeker_32:2.35%
  • thrill_seeker_33:2.34%
  • thrill_seeker_34:2.33%
  • thrill_seeker_35:2.31%
  • thrill_seeker_36:2.30%
  • thrill_seeker_37:2.30%
  • thrill_seeker_38:2.29%
  • thrill_seeker_39:2.27%

Spelldata

  • id:331939
  • name:Thrill Seeker
  • tooltip:At {$u=40} stacks, you will gain Euphoria.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
infernal - infernal: Embers 2.0 0.0 180.8sec 180.8sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_Prep_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.5s
  • trigger_min/max:180.0s / 186.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.8sec 180.8sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_Prep_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.5s
  • trigger_min/max:180.0s / 186.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.53% 7.43% 13.31% 0.8s 0.0s 6.3s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Nadjia_Prep
soul_fire Soul Shard 6.57 7.28 7.56% 1.11 0.42 5.47%
immolate Soul Shard 357.16 34.51 35.84% 0.10 1.20 3.37%
incinerate Soul Shard 43.54 11.01 11.44% 0.25 0.01 0.10%
conflagrate Soul Shard 37.98 28.42 29.51% 0.75 0.00 0.00%
mana_regen Mana 687.41 124793.10 100.00% 181.54 25405.21 16.91%
immolate_crits Soul Shard 34.83 3.36 3.49% 0.10 0.12 3.51%
incinerate_crits Soul Shard 10.70 1.07 1.11% 0.10 0.00 0.06%
infernal Soul Shard 120.00 10.64 11.05% 0.09 1.36 11.32%
pet - imp
energy_regen Energy 373.26 3649.94 100.00% 9.78 22.74 0.62%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 414.65 418.16 25410.2 48943.6 46697.5 50000.0
Soul Shard 4.0 0.32 0.32 3.1 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_Nadjia_Prep
cataclysm Mana 9.8 4875.6 500.0 500.3 48.0
channel_demonfire Mana 13.0 9713.8 750.0 750.3 33.5
chaos_bolt Soul Shard 22.7 45.5 2.0 2.0 12155.4
conflagrate Mana 38.0 18989.1 500.0 499.9 13.0
havoc Mana 9.7 9657.9 1000.0 1000.1 0.0
immolate Mana 28.2 21149.3 750.0 749.9 23.5
impending_catastrophe Mana 4.7 9356.1 2000.0 2003.5 7.5
incinerate Mana 43.5 43541.2 1000.0 999.4 4.2
rain_of_fire Soul Shard 17.2 51.6 3.0 3.0 5214.0
soul_fire Mana 6.6 6570.8 1000.0 1180.1 23.5
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.9
pet - imp
firebolt Energy 95.5 3821.3 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Venthyr_Nadjia_Prep Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
Venthyr_Nadjia_Prep Damage Per Second
Count 627
Mean 9734.21
Minimum 9194.15
Maximum 10381.82
Spread ( max - min ) 1187.67
Range [ ( max - min ) / 2 * 100% ] 6.10%
Standard Deviation 223.2355
5th Percentile 9401.71
95th Percentile 10118.49
( 95th Percentile - 5th Percentile ) 716.78
Mean Distribution
Standard Deviation 8.9152
95.00% Confidence Interval ( 9716.73 - 9751.68 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2021
0.1 Scale Factor Error with Delta=300 426
0.05 Scale Factor Error with Delta=300 1702
0.01 Scale Factor Error with Delta=300 42542
Priority Target DPS
Venthyr_Nadjia_Prep Priority Target Damage Per Second
Count 627
Mean 5197.93
Minimum 4867.85
Maximum 5619.19
Spread ( max - min ) 751.33
Range [ ( max - min ) / 2 * 100% ] 7.23%
Standard Deviation 130.6125
5th Percentile 4990.38
95th Percentile 5415.42
( 95th Percentile - 5th Percentile ) 425.04
Mean Distribution
Standard Deviation 5.2162
95.00% Confidence Interval ( 5187.70 - 5208.15 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2426
0.1 Scale Factor Error with Delta=300 146
0.05 Scale Factor Error with Delta=300 583
0.01 Scale Factor Error with Delta=300 14564
DPS(e)
Venthyr_Nadjia_Prep Damage Per Second (Effective)
Count 627
Mean 9734.21
Minimum 9194.15
Maximum 10381.82
Spread ( max - min ) 1187.67
Range [ ( max - min ) / 2 * 100% ] 6.10%
Damage
Venthyr_Nadjia_Prep Damage
Count 627
Mean 2555797.72
Minimum 2006548.20
Maximum 3109355.36
Spread ( max - min ) 1102807.16
Range [ ( max - min ) / 2 * 100% ] 21.57%
DTPS
Venthyr_Nadjia_Prep Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Nadjia_Prep Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Nadjia_Prep Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Nadjia_Prep Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Nadjia_Prep Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Nadjia_Prep Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_Nadjia_PrepTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Nadjia_Prep Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.50 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.80 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.31 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.95 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.70 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.66 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.89 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 19.12 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.70 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 32.15 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.86 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.15 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.60 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.84 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.64 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFDKLJLJDLALJEHQQRNOFFIFJIELJLALLHNQQPNQELFJFFKLIJL9AEHNQQNPQLLJFLEFFIJALHQRNQPRN9EFIJKFLIJAHRRNQQPEJLLLFMDJFFLDA9EHQNQNPQNFILKFEJAILJLHQRNPQRRN9EFIJLAIJLHQRRNPQEFJKFLLIJALLHNOPQQNEFFFILJLLLA

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.050 cds M summon_infernal Fluffy_Pillow 49775.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, thrill_seeker(3)
0:05.057 aoe H havoc enemy2 49278.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, thrill_seeker(3)
0:06.064 havoc Q chaos_bolt Fluffy_Pillow 48782.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, thrill_seeker(4)
0:08.072 havoc N conflagrate Fluffy_Pillow 49786.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(5)
0:09.078 havoc Q chaos_bolt Fluffy_Pillow 49789.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, thrill_seeker(5)
0:10.484 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, thrill_seeker(6)
0:11.490 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft, thrill_seeker(6)
0:12.497 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, thrill_seeker(7)
0:13.902 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(7)
0:14.909 havoc Q chaos_bolt Fluffy_Pillow 49958.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, thrill_seeker(8)
0:16.315 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, thrill_seeker(9)
0:17.320 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
bloodlust, backdraft, thrill_seeker(9)
0:18.326 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft, thrill_seeker(10)
0:20.669 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
bloodlust, backdraft, thrill_seeker(11)
0:21.676 aoe F immolate enemy2 49252.5/50000: 99% mana
2.6/5: 52% soul_shard
bloodlust, backdraft, thrill_seeker(11)
0:22.682 aoe F immolate enemy3 49005.5/50000: 98% mana
2.9/5: 58% soul_shard
bloodlust, backdraft, thrill_seeker(12)
0:23.688 aoe D rain_of_fire Fluffy_Pillow 48758.5/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft, thrill_seeker(12)
0:24.695 aoe K impending_catastrophe Fluffy_Pillow 49262.0/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft, thrill_seeker(13)
0:26.036 aoe L incinerate Fluffy_Pillow 47932.5/50000: 96% mana
0.9/5: 18% soul_shard
bloodlust, backdraft, thrill_seeker(14)
0:26.976 aoe J conflagrate Fluffy_Pillow 47402.5/50000: 95% mana
1.4/5: 28% soul_shard
bloodlust, thrill_seeker(14)
0:27.982 aoe L incinerate Fluffy_Pillow 47405.5/50000: 95% mana
2.4/5: 48% soul_shard
bloodlust, backdraft, thrill_seeker(14)
0:28.922 aoe J conflagrate Fluffy_Pillow 46875.5/50000: 94% mana
2.9/5: 58% soul_shard
bloodlust, thrill_seeker(15)
0:29.927 aoe D rain_of_fire Fluffy_Pillow 46878.0/50000: 94% mana
3.9/5: 78% soul_shard
bloodlust, backdraft, thrill_seeker(15)
0:30.933 aoe L incinerate Fluffy_Pillow 47381.0/50000: 95% mana
1.4/5: 28% soul_shard
bloodlust, backdraft, thrill_seeker(16)
0:31.874 default A cataclysm Fluffy_Pillow 46851.5/50000: 94% mana
2.0/5: 40% soul_shard
bloodlust, thrill_seeker(16)
0:33.214 aoe L incinerate Fluffy_Pillow 47021.5/50000: 94% mana
2.4/5: 48% soul_shard
bloodlust, thrill_seeker(17)
0:34.554 aoe J conflagrate Fluffy_Pillow 46691.5/50000: 93% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(18)
0:35.691 aoe E channel_demonfire Fluffy_Pillow 46760.0/50000: 94% mana
3.6/5: 72% soul_shard
bloodlust, backdraft, thrill_seeker(18)
0:37.877 aoe H havoc enemy2 47103.0/50000: 94% mana
4.1/5: 82% soul_shard
bloodlust, backdraft, thrill_seeker(19)
0:38.882 havoc Q chaos_bolt Fluffy_Pillow 46605.5/50000: 93% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, thrill_seeker(20)
0:40.288 havoc Q chaos_bolt Fluffy_Pillow 47308.5/50000: 95% mana
2.4/5: 48% soul_shard
bloodlust, thrill_seeker(21)
0:42.298 havoc R incinerate Fluffy_Pillow 48313.5/50000: 97% mana
0.7/5: 14% soul_shard
thrill_seeker(22)
0:44.039 havoc N conflagrate Fluffy_Pillow 48184.0/50000: 96% mana
1.2/5: 24% soul_shard
thrill_seeker(23)
0:45.345 havoc O soul_fire Fluffy_Pillow 48337.0/50000: 97% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(23)
0:48.822 aoe F immolate enemy2 49002.0/50000: 98% mana
4.9/5: 98% soul_shard
backdraft, thrill_seeker(25)
0:50.128 aoe F immolate Fluffy_Pillow 48905.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(26)
0:51.433 aoe I rain_of_fire Fluffy_Pillow 48807.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(26)
0:52.741 aoe F immolate enemy3 49461.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, thrill_seeker(27)
0:54.048 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.3/5: 46% soul_shard
thrill_seeker(28)
0:55.355 aoe I rain_of_fire Fluffy_Pillow 49406.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft, thrill_seeker(28)
0:56.660 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.1/5: 2% soul_shard
backdraft, thrill_seeker(29)
0:59.532 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft, thrill_seeker(30)
1:00.751 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
thrill_seeker(31)
1:02.059 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.5/5: 30% soul_shard
backdraft, thrill_seeker(32)
1:03.277 default A cataclysm Fluffy_Pillow 48765.0/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(32)
1:05.017 aoe L incinerate Fluffy_Pillow 49135.0/50000: 98% mana
2.1/5: 42% soul_shard
thrill_seeker(33)
1:06.757 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
thrill_seeker(34)
1:08.496 aoe H havoc enemy2 48871.5/50000: 98% mana
3.2/5: 64% soul_shard
thrill_seeker(35)
1:09.804 havoc N conflagrate Fluffy_Pillow 48525.5/50000: 97% mana
3.3/5: 66% soul_shard
thrill_seeker(35)
1:11.111 havoc Q chaos_bolt Fluffy_Pillow 48679.0/50000: 97% mana
4.5/5: 90% soul_shard
backdraft, thrill_seeker(36)
1:12.940 havoc Q chaos_bolt Fluffy_Pillow 49593.5/50000: 99% mana
2.6/5: 52% soul_shard
thrill_seeker(37)
1:15.550 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
thrill_seeker(38)
1:16.856 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.3/5: 26% soul_shard
thrill_seeker(39)
1:18.163 havoc Q chaos_bolt Fluffy_Pillow 49405.5/50000: 99% mana
2.3/5: 46% soul_shard
backdraft, euphoria
1:19.686 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
euphoria
1:22.122 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
thrill_seeker(3), euphoria
1:23.576 aoe F immolate enemy3 49003.5/50000: 98% mana
1.5/5: 30% soul_shard
thrill_seeker(3), euphoria
1:24.664 aoe J conflagrate Fluffy_Pillow 48797.5/50000: 98% mana
1.5/5: 30% soul_shard
thrill_seeker(4), euphoria
1:25.752 aoe F immolate Fluffy_Pillow 48841.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(4), euphoria
1:26.842 aoe F immolate enemy2 48636.5/50000: 97% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(5), euphoria
1:27.933 aoe K impending_catastrophe Fluffy_Pillow 48432.0/50000: 97% mana
2.6/5: 52% soul_shard
backdraft, thrill_seeker(5), euphoria
1:29.384 aoe L incinerate Fluffy_Pillow 47157.5/50000: 94% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(6)
1:30.604 aoe I rain_of_fire Fluffy_Pillow 46767.5/50000: 94% mana
3.3/5: 66% soul_shard
thrill_seeker(7)
1:31.909 aoe J conflagrate Fluffy_Pillow 47420.0/50000: 95% mana
0.4/5: 8% soul_shard
thrill_seeker(7)
1:33.216 aoe L incinerate Fluffy_Pillow 47573.5/50000: 95% mana
1.1/5: 22% soul_shard
backdraft, thrill_seeker(8)
1:34.436 default 9 soul_fire Fluffy_Pillow 47183.5/50000: 94% mana
1.5/5: 30% soul_shard
thrill_seeker(9)
1:37.914 default A cataclysm Fluffy_Pillow 47922.5/50000: 96% mana
3.1/5: 62% soul_shard
thrill_seeker(10)
1:39.657 aoe E channel_demonfire Fluffy_Pillow 48294.0/50000: 97% mana
3.2/5: 64% soul_shard
thrill_seeker(11)
1:42.621 aoe H havoc enemy2 49026.0/50000: 98% mana
3.5/5: 70% soul_shard
thrill_seeker(13)
1:43.928 havoc N conflagrate Fluffy_Pillow 48679.5/50000: 97% mana
3.7/5: 74% soul_shard
thrill_seeker(13)
1:45.233 havoc Q chaos_bolt Fluffy_Pillow 48832.0/50000: 98% mana
4.8/5: 96% soul_shard
backdraft, thrill_seeker(14)
1:47.060 havoc Q chaos_bolt Fluffy_Pillow 49745.5/50000: 99% mana
3.0/5: 60% soul_shard
thrill_seeker(15)
1:49.669 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
thrill_seeker(16)
1:50.977 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
backdraft, thrill_seeker(17)
1:52.283 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
backdraft, thrill_seeker(18)
1:54.110 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
thrill_seeker(19)
1:55.850 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
thrill_seeker(19)
1:57.590 aoe J conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
1.6/5: 32% soul_shard
thrill_seeker(20)
1:58.897 aoe F immolate enemy3 49025.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(21)
2:00.204 aoe L incinerate Fluffy_Pillow 48929.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(22)
2:01.424 aoe E channel_demonfire Fluffy_Pillow 48539.0/50000: 97% mana
2.9/5: 58% soul_shard
thrill_seeker(22)
2:04.353 aoe F immolate enemy2 49253.5/50000: 99% mana
3.2/5: 64% soul_shard
thrill_seeker(24)
2:05.660 aoe F immolate Fluffy_Pillow 49157.0/50000: 98% mana
3.3/5: 66% soul_shard
thrill_seeker(24)
2:06.965 aoe I rain_of_fire Fluffy_Pillow 49059.5/50000: 98% mana
3.5/5: 70% soul_shard
thrill_seeker(25)
2:08.271 aoe J conflagrate Fluffy_Pillow 49712.5/50000: 99% mana
0.6/5: 12% soul_shard
thrill_seeker(26)
2:09.576 default A cataclysm Fluffy_Pillow 49865.0/50000: 100% mana
1.3/5: 26% soul_shard
backdraft, thrill_seeker(26)
2:11.390 aoe L incinerate Fluffy_Pillow 49502.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft, thrill_seeker(27)
2:12.610 aoe H havoc enemy2 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
thrill_seeker(28)
2:13.927 havoc Q chaos_bolt Fluffy_Pillow 48661.0/50000: 97% mana
2.0/5: 40% soul_shard
thrill_seeker(28)
2:16.536 havoc R incinerate Fluffy_Pillow 49965.5/50000: 100% mana
0.5/5: 10% soul_shard
thrill_seeker(30)
2:18.277 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
thrill_seeker(31)
2:19.583 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft, thrill_seeker(31)
2:21.412 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
thrill_seeker(32)
2:22.720 havoc R incinerate Fluffy_Pillow 49253.0/50000: 99% mana
0.6/5: 12% soul_shard
thrill_seeker(33)
2:24.460 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
thrill_seeker(34)
2:25.768 default 9 soul_fire Fluffy_Pillow 49156.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(34)
2:29.246 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft, thrill_seeker(36)
2:32.054 aoe F immolate enemy3 49656.5/50000: 99% mana
4.2/5: 84% soul_shard
backdraft, thrill_seeker(38)
2:33.361 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.4/5: 88% soul_shard
backdraft, thrill_seeker(38)
2:34.668 aoe J conflagrate Fluffy_Pillow 49906.0/50000: 100% mana
1.5/5: 30% soul_shard
thrill_seeker(39)
2:35.974 aoe K impending_catastrophe Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft, thrill_seeker(39)
2:37.715 aoe F immolate enemy2 48002.5/50000: 96% mana
2.4/5: 48% soul_shard
backdraft, euphoria
2:38.803 aoe L incinerate Fluffy_Pillow 47796.5/50000: 96% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker, euphoria
2:39.820 aoe I rain_of_fire Fluffy_Pillow 47305.0/50000: 95% mana
3.1/5: 62% soul_shard
thrill_seeker, euphoria
2:40.909 aoe J conflagrate Fluffy_Pillow 47849.5/50000: 96% mana
0.2/5: 4% soul_shard
thrill_seeker(3), euphoria
2:41.999 default A cataclysm Fluffy_Pillow 47894.5/50000: 96% mana
0.9/5: 18% soul_shard
backdraft, thrill_seeker(3), euphoria
2:43.451 aoe H havoc enemy2 48120.5/50000: 96% mana
1.1/5: 22% soul_shard
backdraft, thrill_seeker(4), euphoria
2:44.541 havoc R incinerate Fluffy_Pillow 47665.5/50000: 95% mana
1.2/5: 24% soul_shard
backdraft, thrill_seeker(5), euphoria
2:45.557 havoc R incinerate Fluffy_Pillow 47173.5/50000: 94% mana
1.9/5: 38% soul_shard
thrill_seeker(5), euphoria
2:47.009 havoc N conflagrate Fluffy_Pillow 46899.5/50000: 94% mana
2.6/5: 52% soul_shard
thrill_seeker(6)
2:48.479 havoc Q chaos_bolt Fluffy_Pillow 47134.5/50000: 94% mana
3.8/5: 76% soul_shard
backdraft, thrill_seeker(7)
2:50.306 havoc Q chaos_bolt Fluffy_Pillow 48048.0/50000: 96% mana
2.1/5: 42% soul_shard
thrill_seeker(8)
2:52.914 havoc P immolate Fluffy_Pillow 49352.0/50000: 99% mana
0.4/5: 8% soul_shard
thrill_seeker(9)
2:54.221 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
0.5/5: 10% soul_shard
thrill_seeker(10)
2:56.978 aoe J conflagrate Fluffy_Pillow 49881.0/50000: 100% mana
0.9/5: 18% soul_shard
thrill_seeker(11)
2:58.285 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
backdraft, thrill_seeker(12)
2:59.506 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.9/5: 38% soul_shard
thrill_seeker(12)
3:01.245 aoe L incinerate Fluffy_Pillow 48872.5/50000: 98% mana
2.3/5: 46% soul_shard
thrill_seeker(13)
3:02.986 aoe F immolate enemy3 48743.0/50000: 97% mana
2.8/5: 56% soul_shard
thrill_seeker(14)
3:04.291 cds M summon_infernal Fluffy_Pillow 48645.5/50000: 97% mana
3.0/5: 60% soul_shard
thrill_seeker(15)
3:05.597 aoe D rain_of_fire Fluffy_Pillow 48298.5/50000: 97% mana
3.3/5: 66% soul_shard
thrill_seeker(15)
3:06.901 aoe J conflagrate Fluffy_Pillow 48950.5/50000: 98% mana
0.9/5: 18% soul_shard
thrill_seeker(16)
3:08.207 aoe F immolate enemy2 49103.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft, thrill_seeker(17)
3:09.513 aoe F immolate Fluffy_Pillow 49006.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(17)
3:10.820 aoe L incinerate Fluffy_Pillow 48910.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(18)
3:12.039 aoe D rain_of_fire Fluffy_Pillow 48519.5/50000: 97% mana
3.2/5: 64% soul_shard
thrill_seeker(19)
3:13.344 default A cataclysm Fluffy_Pillow 49172.0/50000: 98% mana
0.8/5: 16% soul_shard
thrill_seeker(19)
3:15.184 default 9 soul_fire Fluffy_Pillow 49501.0/50000: 99% mana
1.4/5: 28% soul_shard
thrill_seeker(20)
3:18.661 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
3.6/5: 72% soul_shard
thrill_seeker(22)
3:21.531 aoe H havoc enemy2 49687.0/50000: 99% mana
4.6/5: 92% soul_shard
thrill_seeker(23)
3:22.838 havoc Q chaos_bolt Fluffy_Pillow 49340.5/50000: 99% mana
5.0/5: 100% soul_shard
thrill_seeker(24)
3:25.449 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(25)
3:26.754 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft, thrill_seeker(26)
3:28.583 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
thrill_seeker(27)
3:29.888 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft, thrill_seeker(27)
3:31.195 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.9/5: 98% soul_shard
backdraft, thrill_seeker(28)
3:33.023 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(29)
3:34.329 aoe F immolate enemy3 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft, thrill_seeker(30)
3:35.635 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
4.6/5: 92% soul_shard
backdraft, thrill_seeker(30)
3:36.943 aoe L incinerate Fluffy_Pillow 49906.0/50000: 100% mana
1.8/5: 36% soul_shard
backdraft, thrill_seeker(31)
3:38.161 aoe K impending_catastrophe Fluffy_Pillow 49001.5/50000: 98% mana
2.1/5: 42% soul_shard
thrill_seeker(32)
3:39.901 aoe F immolate enemy2 47871.5/50000: 96% mana
2.4/5: 48% soul_shard
thrill_seeker(32)
3:41.206 aoe E channel_demonfire Fluffy_Pillow 47774.0/50000: 96% mana
2.4/5: 48% soul_shard
thrill_seeker(33)
3:44.015 aoe J conflagrate Fluffy_Pillow 48428.5/50000: 97% mana
2.7/5: 54% soul_shard
thrill_seeker(35)
3:45.322 default A cataclysm Fluffy_Pillow 48582.0/50000: 97% mana
3.5/5: 70% soul_shard
backdraft, thrill_seeker(35)
3:47.063 aoe I rain_of_fire Fluffy_Pillow 48952.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft, thrill_seeker(36)
3:48.369 aoe L incinerate Fluffy_Pillow 49605.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft, thrill_seeker(37)
3:49.588 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
thrill_seeker(37)
3:50.896 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.8/5: 36% soul_shard
backdraft, thrill_seeker(38)
3:52.115 aoe H havoc enemy2 48765.5/50000: 98% mana
2.1/5: 42% soul_shard
thrill_seeker(39)
3:53.422 havoc Q chaos_bolt Fluffy_Pillow 48419.0/50000: 97% mana
2.3/5: 46% soul_shard
thrill_seeker(39)
3:56.032 havoc R incinerate Fluffy_Pillow 49724.0/50000: 99% mana
0.6/5: 12% soul_shard
thrill_seeker, euphoria
3:57.484 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
thrill_seeker, euphoria
3:58.573 havoc P immolate Fluffy_Pillow 49047.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(3), euphoria
3:59.662 havoc Q chaos_bolt Fluffy_Pillow 48841.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(3), euphoria
4:01.186 havoc R incinerate Fluffy_Pillow 49603.5/50000: 99% mana
1.0/5: 20% soul_shard
thrill_seeker(4), euphoria
4:02.635 havoc R incinerate Fluffy_Pillow 49001.0/50000: 98% mana
1.6/5: 32% soul_shard
thrill_seeker(5), euphoria
4:04.086 havoc N conflagrate Fluffy_Pillow 48726.5/50000: 97% mana
2.4/5: 48% soul_shard
thrill_seeker(6)
4:05.394 default 9 soul_fire Fluffy_Pillow 48880.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, thrill_seeker(6)
4:08.870 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(8)
4:11.723 aoe F immolate enemy3 49678.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(9)
4:13.030 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(10)
4:14.338 aoe J conflagrate Fluffy_Pillow 49906.5/50000: 100% mana
2.2/5: 44% soul_shard
thrill_seeker(11)
4:15.645 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(11)
4:16.865 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
3.3/5: 66% soul_shard
thrill_seeker(12)
4:18.799 aoe I rain_of_fire Fluffy_Pillow 49469.5/50000: 99% mana
3.6/5: 72% soul_shard
thrill_seeker(13)
4:20.106 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
thrill_seeker(14)
4:21.615 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
backdraft, thrill_seeker(14)
4:22.834 aoe H havoc enemy2 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
thrill_seeker(15)
4:24.140 havoc Q chaos_bolt Fluffy_Pillow 48655.0/50000: 97% mana
2.0/5: 40% soul_shard
thrill_seeker(16)
4:26.749 havoc R incinerate Fluffy_Pillow 49959.5/50000: 100% mana
0.3/5: 6% soul_shard
thrill_seeker(17)
4:28.488 havoc R incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.7/5: 14% soul_shard
thrill_seeker(18)
4:30.227 havoc N conflagrate Fluffy_Pillow 48871.0/50000: 98% mana
1.5/5: 30% soul_shard
thrill_seeker(19)
4:31.533 havoc P immolate Fluffy_Pillow 49024.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, thrill_seeker(19)
4:32.840 havoc Q chaos_bolt Fluffy_Pillow 48927.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(20)
4:34.666 aoe E channel_demonfire Fluffy_Pillow 49840.5/50000: 100% mana
1.0/5: 20% soul_shard
thrill_seeker(21)
4:37.440 aoe F immolate enemy3 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
thrill_seeker(22)
4:38.747 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.4/5: 28% soul_shard
thrill_seeker(23)
4:40.055 aoe K impending_catastrophe Fluffy_Pillow 49406.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, thrill_seeker(24)
4:41.795 aoe F immolate enemy2 48002.0/50000: 96% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(24)
4:43.101 aoe L incinerate Fluffy_Pillow 47905.0/50000: 96% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(25)
4:44.320 aoe L incinerate Fluffy_Pillow 47514.5/50000: 95% mana
2.9/5: 58% soul_shard
thrill_seeker(26)
4:46.060 aoe I rain_of_fire Fluffy_Pillow 47384.5/50000: 95% mana
3.3/5: 66% soul_shard
thrill_seeker(27)
4:47.367 aoe J conflagrate Fluffy_Pillow 48038.0/50000: 96% mana
0.4/5: 8% soul_shard
thrill_seeker(27)
4:48.673 default A cataclysm Fluffy_Pillow 48191.0/50000: 96% mana
1.1/5: 22% soul_shard
backdraft, thrill_seeker(28)
4:50.534 aoe L incinerate Fluffy_Pillow 48621.5/50000: 97% mana
1.5/5: 30% soul_shard
backdraft, thrill_seeker(29)
4:51.755 aoe L incinerate Fluffy_Pillow 48232.0/50000: 96% mana
1.8/5: 36% soul_shard
thrill_seeker(29)
4:53.495 aoe H havoc enemy2 48102.0/50000: 96% mana
2.2/5: 44% soul_shard
thrill_seeker(30)
4:54.800 havoc N conflagrate Fluffy_Pillow 47754.5/50000: 96% mana
2.4/5: 48% soul_shard
thrill_seeker(31)
4:56.211 havoc O soul_fire Fluffy_Pillow 47960.0/50000: 96% mana
3.5/5: 70% soul_shard
backdraft, thrill_seeker(32)
4:59.689 havoc P immolate Fluffy_Pillow 48699.0/50000: 97% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(33)
5:00.996 havoc Q chaos_bolt Fluffy_Pillow 48602.5/50000: 97% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(34)
5:02.825 havoc Q chaos_bolt Fluffy_Pillow 49517.0/50000: 99% mana
3.0/5: 60% soul_shard
thrill_seeker(35)
5:05.434 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
thrill_seeker(36)
5:06.740 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
backdraft, thrill_seeker(37)
5:09.654 aoe F immolate enemy3 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft, thrill_seeker(38)
5:10.960 aoe F immolate enemy2 49252.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft, thrill_seeker(39)
5:12.266 aoe F immolate Fluffy_Pillow 49155.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, euphoria
5:13.357 aoe I rain_of_fire Fluffy_Pillow 48950.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft, euphoria
5:14.447 aoe L incinerate Fluffy_Pillow 49495.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft, thrill_seeker, euphoria
5:15.463 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
thrill_seeker, euphoria
5:16.552 aoe L incinerate Fluffy_Pillow 49046.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft, thrill_seeker(3), euphoria
5:17.568 aoe L incinerate Fluffy_Pillow 48554.5/50000: 97% mana
2.0/5: 40% soul_shard
thrill_seeker(3), euphoria
5:19.018 aoe L incinerate Fluffy_Pillow 48279.5/50000: 97% mana
2.4/5: 48% soul_shard
thrill_seeker(4), euphoria
5:20.471 default A cataclysm Fluffy_Pillow 48006.0/50000: 96% mana
2.7/5: 54% soul_shard
thrill_seeker(5), euphoria

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_Nadjia_Prep"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=331580/331586/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_Theotar : 9783 dps, 5256 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9782.5 9782.5 18.5 / 0.189% 888.8 / 9.1% 20.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
410.1 406.7 Mana 0.00% 38.1 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Theotar 9783
Cataclysm 793 8.1% 9.7 32.39sec 24622 14491 Direct 29.0 6881 13752 8215 19.3%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.68 29.05 0.00 0.00 1.6992 0.0000 238403.26 238403.26 0.00% 14490.84 14490.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 23.44 15 33 6881.05 6142 8767 6880.92 6492 7499 161254 161254 0.00%
crit 19.32% 5.61 0 14 13752.42 12285 17526 13644.84 0 16894 77149 77149 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.74
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1055) 0.0% (10.8%) 12.3 25.57sec 25866 9590

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.27 0.00 183.35 0.00 2.6973 0.1635 0.00 0.00 0.00% 9589.64 9589.64

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.27
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1055 10.8% 0.0 0.00sec 0 0 Direct 550.0 483 968 577 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 550.04 0.00 0.00 0.0000 0.0000 317359.40 317359.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 443.72 318 562 483.16 263 1179 483.38 458 524 214408 214408 0.00%
crit 19.33% 106.33 66 154 967.83 525 2357 968.86 832 1132 102952 102952 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1393 (1873) 14.2% (19.1%) 22.7 12.99sec 24821 12616 Direct 45.1 (89.8) 0 9282 9282 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.67 45.10 0.00 0.00 1.9674 0.0000 418540.45 418540.45 0.00% 12616.09 12616.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 45.10 32 58 9282.08 5864 14781 9281.06 8861 9885 418540 418540 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.76
  • if_expr:cast_time<havoc_remains
    Internal Combustion 480 4.9% 44.7 12.93sec 3221 0 Direct 44.7 2702 5405 3224 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.72 44.72 0.00 0.00 0.0000 0.0000 144036.42 144036.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 36.11 23 53 2702.20 1 4484 2702.59 2463 2982 97553 97553 0.00%
crit 19.24% 8.60 1 17 5404.78 2 8968 5395.22 3342 7109 46484 46484 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 826 8.5% 37.2 7.95sec 6678 5342 Direct 56.0 3717 7430 4432 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.20 56.04 0.00 0.00 1.2501 0.0000 248398.35 248398.35 0.00% 5342.01 5342.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 45.23 29 61 3716.99 2047 6088 3716.88 3453 4037 168102 168102 0.00%
crit 19.29% 10.81 3 22 7430.36 4095 12175 7426.22 5298 9722 80296 80296 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.39
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.79
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1654 16.9% 28.3 10.26sec 17576 13904 Direct 35.2 1583 3149 1890 19.6%
Periodic 346.8 1041 2080 1242 19.4% 95.3%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.31 35.22 346.83 346.83 1.2641 2.4820 497542.70 497542.70 0.00% 554.90 13904.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.42% 28.33 18 41 1583.47 819 2435 1584.41 1449 1753 44856 44856 0.00%
crit 19.58% 6.90 1 15 3149.26 1639 4865 3145.69 2344 4118 21719 21719 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.58% 279.47 206 347 1040.72 0 1522 1040.73 1011 1080 290835 290835 0.00%
crit 19.42% 67.36 41 101 2079.71 1 3044 2080.49 1941 2243 140132 140132 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:20.09
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.29
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (227) 0.0% (2.3%) 4.7 64.45sec 14513 8769

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.69 0.00 0.00 0.00 1.6552 0.0000 0.00 0.00 0.00% 8769.28 8769.28

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.73
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 14.0 558 1116 666 19.3%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.99 0.00 0.00 0.0000 0.0000 9313.72 9313.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 11.28 5 17 558.02 558 558 558.02 558 558 6295 6295 0.00%
crit 19.34% 2.70 0 10 1116.04 1116 1116 1059.09 0 1116 3019 3019 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 196 2.0% 0.0 0.00sec 0 0 Periodic 102.0 484 967 576 19.1% 18.2%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 102.05 102.05 0.0000 1.6137 58762.22 58762.22 0.00% 356.83 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.92% 82.58 57 102 483.62 446 488 483.64 482 486 39936 39936 0.00%
crit 19.08% 19.47 7 33 966.94 891 977 966.90 950 977 18826 18826 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 590 6.1% 42.0 6.51sec 4244 2898 Direct 52.7 (52.7) 2848 5678 3380 18.8% (18.8%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.96 52.70 0.00 0.00 1.4643 0.0000 178061.96 178061.96 0.00% 2898.43 2898.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.21% 42.79 23 64 2848.08 1391 4137 2850.36 2593 3083 121871 121871 0.00%
crit 18.79% 9.90 2 21 5677.83 2780 8272 5685.94 4359 7045 56191 56191 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:31.07
    havoc
    [R]:11.13
  • if_expr:cast_time<havoc_remains
Rain of Fire 878 9.0% 16.4 17.33sec 16062 12864 Periodic 389.5 568 1137 678 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.44 0.00 0.00 389.53 1.2486 0.0000 263979.00 263979.00 0.00% 12863.85 12863.85
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.74% 314.52 205 482 568.06 507 723 568.09 550 596 178676 178676 0.00%
crit 19.26% 75.01 37 123 1136.97 1013 1446 1137.20 1087 1197 85303 85303 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.11
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.32
Soul Fire 521 5.3% 5.6 49.56sec 28040 8063 Direct 7.6 17120 34201 20634 20.6%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.59 7.59 0.00 0.00 3.4775 0.0000 156656.86 156656.86 0.00% 8063.46 8063.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.36% 6.02 2 10 17120.07 8600 25558 17135.00 12965 20438 103048 103048 0.00%
crit 20.64% 1.57 0 6 34200.92 17888 51094 28091.70 0 50636 53609 53609 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.62
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.06
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.48sec 12009 10384 Direct 6.0 3348 6696 3996 19.6%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24019.00 24019.00 0.00% 10384.35 10384.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.44% 4.83 1 6 3348.13 3348 3348 3348.13 3348 3348 16159 16159 0.00%
crit 19.56% 1.17 0 5 6696.27 6696 6696 4837.97 0 6696 7860 7860 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3811 / 770
Immolation 3546 7.2% 39.0 5.49sec 5455 0 Direct 117.0 1529 3058 1818 18.9%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 212757.40 212757.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.08% 94.87 81 109 1529.21 1395 2023 1529.23 1495 1562 145075 145075 0.00%
crit 18.92% 22.13 8 36 3058.30 2790 4046 3057.99 2826 3371 67683 67683 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.2%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15904.81 22718.43 29.99% 270.01 270.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.84% 33.15 24 40 325.55 326 326 325.55 326 326 10790 15413 29.99%
crit 19.16% 7.85 1 17 651.10 651 651 651.10 651 651 5114 7305 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.3% 93.6 3.21sec 1653 1135 Direct 92.9 1395 2790 1665 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.58 92.89 0.00 0.00 1.4562 0.0000 154648.77 154648.77 0.00% 1134.83 1134.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 74.93 53 97 1395.06 1395 1395 1395.06 1395 1395 104534 104534 0.00%
crit 19.34% 17.96 5 31 2790.11 2790 2790 2790.11 2790 2790 50115 50115 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:94.02
Simple Action Stats Execute Interval
Venthyr_Theotar
Havoc 9.6 32.22sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.64 0.00 0.00 0.00 1.2443 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.65
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.2 0.0 8.0sec 8.0sec 4.4sec 54.03% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.3s
  • trigger_min/max:1.9s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.03%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soothing Shade 4.2 0.0 62.2sec 62.2sec 11.8sec 16.36% 0.00% 0.0 (0.0) 4.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_soothing_shade
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:525.00

Trigger Details

  • interval_min/max:20.0s / 203.8s
  • trigger_min/max:20.0s / 203.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • soothing_shade_1:16.36%

Spelldata

  • id:336885
  • name:Soothing Shade
  • tooltip:Standing in the shade makes it easier to focus, increasing your Mastery by $w1.
  • description:{$@spelldesc336239=Your spells and abilities have a chance to call Tubbins and Gubbins to your side for {$336808d=12 seconds}, parasol in hand. Standing in the shaded area grants you {$336885s1=525} Mastery.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 184.7s
  • trigger_min/max:180.0s / 184.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 184.7s
  • trigger_min/max:180.0s / 184.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 11.53% 8.66% 14.37% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Theotar
soul_fire Soul Shard 6.59 7.22 7.71% 1.10 0.42 5.47%
immolate Soul Shard 346.78 33.43 35.65% 0.10 1.25 3.60%
incinerate Soul Shard 41.96 10.60 11.31% 0.25 0.00 0.03%
conflagrate Soul Shard 37.18 28.01 29.87% 0.75 0.00 0.00%
mana_regen Mana 657.93 122432.32 100.00% 186.09 27763.91 18.49%
immolate_crits Soul Shard 33.57 3.24 3.46% 0.10 0.12 3.47%
incinerate_crits Soul Shard 9.91 0.99 1.06% 0.10 0.00 0.02%
infernal Soul Shard 120.00 10.26 10.94% 0.09 1.74 14.49%
pet - imp
energy_regen Energy 362.19 3571.98 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 406.73 410.12 27791.8 48980.0 46946.5 50000.0
Soul Shard 4.0 0.31 0.31 3.5 2.1 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_Theotar
cataclysm Mana 9.7 4845.3 500.0 500.4 49.2
channel_demonfire Mana 12.3 9200.6 750.0 749.9 34.5
chaos_bolt Soul Shard 22.6 45.3 2.0 2.0 12422.3
conflagrate Mana 37.2 18591.8 500.0 499.8 13.4
havoc Mana 9.7 9650.1 1000.0 1000.8 0.0
immolate Mana 28.3 21220.5 750.0 749.6 23.4
impending_catastrophe Mana 4.7 9396.6 2000.0 2003.3 7.2
incinerate Mana 42.0 41962.7 1000.0 1000.2 4.2
rain_of_fire Soul Shard 16.4 49.3 3.0 3.0 5355.9
soul_fire Mana 6.6 6594.1 1000.0 1180.3 23.8
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.6 3742.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Venthyr_Theotar Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
Venthyr_Theotar Damage Per Second
Count 627
Mean 9782.54
Minimum 9241.46
Maximum 10563.07
Spread ( max - min ) 1321.61
Range [ ( max - min ) / 2 * 100% ] 6.75%
Standard Deviation 236.7789
5th Percentile 9431.20
95th Percentile 10175.83
( 95th Percentile - 5th Percentile ) 744.63
Mean Distribution
Standard Deviation 9.4560
95.00% Confidence Interval ( 9764.01 - 9801.07 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2251
0.1 Scale Factor Error with Delta=300 479
0.05 Scale Factor Error with Delta=300 1915
0.01 Scale Factor Error with Delta=300 47860
Priority Target DPS
Venthyr_Theotar Priority Target Damage Per Second
Count 627
Mean 5255.65
Minimum 4942.81
Maximum 5741.50
Spread ( max - min ) 798.69
Range [ ( max - min ) / 2 * 100% ] 7.60%
Standard Deviation 138.4433
5th Percentile 5039.69
95th Percentile 5490.19
( 95th Percentile - 5th Percentile ) 450.50
Mean Distribution
Standard Deviation 5.5289
95.00% Confidence Interval ( 5244.81 - 5266.49 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2666
0.1 Scale Factor Error with Delta=300 164
0.05 Scale Factor Error with Delta=300 655
0.01 Scale Factor Error with Delta=300 16362
DPS(e)
Venthyr_Theotar Damage Per Second (Effective)
Count 627
Mean 9782.54
Minimum 9241.46
Maximum 10563.07
Spread ( max - min ) 1321.61
Range [ ( max - min ) / 2 * 100% ] 6.75%
Damage
Venthyr_Theotar Damage
Count 627
Mean 2555073.35
Minimum 2003029.66
Maximum 3091343.13
Spread ( max - min ) 1088313.47
Range [ ( max - min ) / 2 * 100% ] 21.30%
DTPS
Venthyr_Theotar Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Theotar Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Theotar Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Theotar Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Theotar Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Theotar Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_TheotarTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Theotar Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.62 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.74 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.11 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.27 channel_demonfire,if=dot.immolate.remains>cast_time
F 20.09 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.65 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.32 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.39 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.73 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 31.07 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.79 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.06 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.29 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.76 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.13 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFKDLJLJDLALJEHQQRNOFFIFJLEIJLALLHNQQPRNELFIJKLLL9AHQNQNQPNELILFFFJLLLAHNQQNQP9EJFIFKLJLLAHNQQRNPEILJLFMLDJLL9AEHQNQNPQDLJFKEFFLJIAHRNQRRQP9EFFJILJLJLAHQNQRRPNEIKFLJLILL9AHNQNQRQPEFJFLJF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.037 cds M summon_infernal Fluffy_Pillow 49768.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.043 aoe H havoc enemy2 49271.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.048 havoc Q chaos_bolt Fluffy_Pillow 48774.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:08.056 havoc N conflagrate Fluffy_Pillow 49778.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:09.061 havoc Q chaos_bolt Fluffy_Pillow 49780.5/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.468 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.475 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.482 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.890 havoc N conflagrate Fluffy_Pillow 49956.5/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:14.896 havoc Q chaos_bolt Fluffy_Pillow 49959.5/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:16.302 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:17.306 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:18.312 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
bloodlust, backdraft
0:20.663 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:21.669 aoe F immolate enemy2 49252.0/50000: 99% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:22.676 aoe F immolate enemy3 49005.5/50000: 98% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:23.683 aoe K impending_catastrophe Fluffy_Pillow 48759.0/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:25.024 aoe D rain_of_fire Fluffy_Pillow 47429.5/50000: 95% mana
3.4/5: 68% soul_shard
bloodlust, backdraft
0:26.031 aoe L incinerate Fluffy_Pillow 47933.0/50000: 96% mana
0.8/5: 16% soul_shard
bloodlust, backdraft
0:26.970 aoe J conflagrate Fluffy_Pillow 47402.5/50000: 95% mana
1.3/5: 26% soul_shard
bloodlust
0:27.977 aoe L incinerate Fluffy_Pillow 47406.0/50000: 95% mana
2.2/5: 44% soul_shard
bloodlust, backdraft
0:28.917 aoe J conflagrate Fluffy_Pillow 46876.0/50000: 94% mana
2.8/5: 56% soul_shard
bloodlust
0:29.924 aoe D rain_of_fire Fluffy_Pillow 46879.5/50000: 94% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:30.929 aoe L incinerate Fluffy_Pillow 47382.0/50000: 95% mana
1.0/5: 20% soul_shard
bloodlust, backdraft
0:31.868 default A cataclysm Fluffy_Pillow 46851.5/50000: 94% mana
1.7/5: 34% soul_shard
bloodlust
0:33.208 aoe L incinerate Fluffy_Pillow 47021.5/50000: 94% mana
2.1/5: 42% soul_shard
bloodlust
0:34.549 aoe J conflagrate Fluffy_Pillow 46692.0/50000: 93% mana
2.7/5: 54% soul_shard
bloodlust
0:35.676 aoe E channel_demonfire Fluffy_Pillow 46755.5/50000: 94% mana
3.4/5: 68% soul_shard
bloodlust, backdraft
0:37.941 aoe H havoc enemy2 47138.0/50000: 94% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:38.949 havoc Q chaos_bolt Fluffy_Pillow 46642.0/50000: 93% mana
4.1/5: 82% soul_shard
bloodlust, backdraft
0:40.354 havoc Q chaos_bolt Fluffy_Pillow 47344.5/50000: 95% mana
2.3/5: 46% soul_shard
bloodlust
0:42.361 havoc R incinerate Fluffy_Pillow 48348.0/50000: 97% mana
0.7/5: 14% soul_shard
0:44.103 havoc N conflagrate Fluffy_Pillow 48219.0/50000: 96% mana
1.2/5: 24% soul_shard
0:45.409 havoc O soul_fire Fluffy_Pillow 48372.0/50000: 97% mana
2.5/5: 50% soul_shard
backdraft
0:48.886 aoe F immolate enemy2 49002.0/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
0:50.195 aoe F immolate Fluffy_Pillow 48906.5/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
0:51.502 aoe I rain_of_fire Fluffy_Pillow 48810.0/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
0:52.809 aoe F immolate enemy3 49463.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
0:54.117 aoe J conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
2.2/5: 44% soul_shard
soothing_shade
0:55.424 aoe L incinerate Fluffy_Pillow 49406.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft, soothing_shade
0:56.644 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
soothing_shade
0:59.456 aoe I rain_of_fire Fluffy_Pillow 49658.5/50000: 99% mana
3.5/5: 70% soul_shard
soothing_shade
1:00.761 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
soothing_shade
1:02.066 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
backdraft, soothing_shade
1:03.286 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
soothing_shade
1:05.028 aoe L incinerate Fluffy_Pillow 49373.5/50000: 99% mana
1.9/5: 38% soul_shard
soothing_shade
1:06.768 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.4/5: 48% soul_shard
1:08.509 aoe H havoc enemy2 48872.5/50000: 98% mana
2.8/5: 56% soul_shard
1:09.815 havoc N conflagrate Fluffy_Pillow 48525.5/50000: 97% mana
2.9/5: 58% soul_shard
1:11.121 havoc Q chaos_bolt Fluffy_Pillow 48678.5/50000: 97% mana
4.1/5: 82% soul_shard
backdraft
1:12.948 havoc Q chaos_bolt Fluffy_Pillow 49592.0/50000: 99% mana
2.2/5: 44% soul_shard
1:15.557 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
1:16.864 havoc R incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
1:18.606 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.3/5: 26% soul_shard
1:19.913 aoe E channel_demonfire Fluffy_Pillow 49156.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:22.698 aoe L incinerate Fluffy_Pillow 49799.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
1:23.917 aoe F immolate enemy3 49002.0/50000: 98% mana
3.1/5: 62% soul_shard
1:25.225 aoe I rain_of_fire Fluffy_Pillow 48906.0/50000: 98% mana
3.3/5: 66% soul_shard
1:26.531 aoe J conflagrate Fluffy_Pillow 49559.0/50000: 99% mana
0.5/5: 10% soul_shard
1:27.839 aoe K impending_catastrophe Fluffy_Pillow 49713.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
1:29.578 aoe L incinerate Fluffy_Pillow 48001.5/50000: 96% mana
1.4/5: 28% soul_shard
backdraft
1:30.796 aoe L incinerate Fluffy_Pillow 47610.5/50000: 95% mana
1.7/5: 34% soul_shard
1:32.538 aoe L incinerate Fluffy_Pillow 47481.5/50000: 95% mana
2.2/5: 44% soul_shard
1:34.279 default 9 soul_fire Fluffy_Pillow 47352.0/50000: 95% mana
2.5/5: 50% soul_shard
1:37.758 default A cataclysm Fluffy_Pillow 48091.5/50000: 96% mana
4.0/5: 80% soul_shard
1:39.499 aoe H havoc enemy2 48462.0/50000: 97% mana
4.1/5: 82% soul_shard
1:40.806 havoc Q chaos_bolt Fluffy_Pillow 48115.5/50000: 96% mana
4.1/5: 82% soul_shard
1:43.415 havoc N conflagrate Fluffy_Pillow 49420.0/50000: 99% mana
2.4/5: 48% soul_shard
1:44.722 havoc Q chaos_bolt Fluffy_Pillow 49573.5/50000: 99% mana
3.7/5: 74% soul_shard
backdraft
1:46.550 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
1:47.856 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
1:49.684 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
1:50.989 havoc N conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
1.2/5: 24% soul_shard
1:52.295 aoe E channel_demonfire Fluffy_Pillow 49404.5/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
1:55.160 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
1:56.379 aoe I rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.1/5: 62% soul_shard
1:57.686 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
0.3/5: 6% soul_shard
1:59.428 aoe F immolate enemy3 49003.0/50000: 98% mana
0.7/5: 14% soul_shard
2:00.735 aoe F immolate enemy2 48906.5/50000: 98% mana
0.9/5: 18% soul_shard
2:02.043 aoe F immolate Fluffy_Pillow 48810.5/50000: 98% mana
1.0/5: 20% soul_shard
2:03.349 aoe J conflagrate Fluffy_Pillow 48713.5/50000: 97% mana
1.3/5: 26% soul_shard
2:04.656 aoe L incinerate Fluffy_Pillow 48867.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
2:05.876 aoe L incinerate Fluffy_Pillow 48477.0/50000: 97% mana
2.3/5: 46% soul_shard
2:07.617 aoe L incinerate Fluffy_Pillow 48347.5/50000: 97% mana
2.6/5: 52% soul_shard
2:09.357 default A cataclysm Fluffy_Pillow 48217.5/50000: 96% mana
3.1/5: 62% soul_shard
2:11.236 aoe H havoc enemy2 48657.0/50000: 97% mana
3.3/5: 66% soul_shard
2:12.543 havoc N conflagrate Fluffy_Pillow 48310.5/50000: 97% mana
3.5/5: 70% soul_shard
2:13.851 havoc Q chaos_bolt Fluffy_Pillow 48464.5/50000: 97% mana
4.8/5: 96% soul_shard
backdraft
2:15.679 havoc Q chaos_bolt Fluffy_Pillow 49378.5/50000: 99% mana
3.0/5: 60% soul_shard
2:18.290 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
2:19.597 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft
2:21.424 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
soothing_shade
2:22.731 default 9 soul_fire Fluffy_Pillow 49252.5/50000: 99% mana
1.1/5: 22% soul_shard
soothing_shade
2:26.229 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
soothing_shade
2:29.068 aoe J conflagrate Fluffy_Pillow 49671.5/50000: 99% mana
2.9/5: 58% soul_shard
soothing_shade
2:30.375 aoe F immolate enemy3 49825.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft, soothing_shade
2:31.681 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.9/5: 78% soul_shard
backdraft
2:32.988 aoe F immolate enemy2 49905.5/50000: 100% mana
1.0/5: 20% soul_shard
backdraft
2:34.294 aoe K impending_catastrophe Fluffy_Pillow 49252.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
2:36.035 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
1.4/5: 28% soul_shard
backdraft
2:37.255 aoe J conflagrate Fluffy_Pillow 47612.5/50000: 95% mana
1.8/5: 36% soul_shard
2:38.562 aoe L incinerate Fluffy_Pillow 47766.0/50000: 96% mana
2.4/5: 48% soul_shard
backdraft
2:39.782 aoe L incinerate Fluffy_Pillow 47376.0/50000: 95% mana
2.8/5: 56% soul_shard
2:41.522 default A cataclysm Fluffy_Pillow 47246.0/50000: 94% mana
3.1/5: 62% soul_shard
2:43.261 aoe H havoc enemy2 47615.5/50000: 95% mana
3.4/5: 68% soul_shard
2:44.566 havoc N conflagrate Fluffy_Pillow 47268.0/50000: 95% mana
3.7/5: 74% soul_shard
2:45.873 havoc Q chaos_bolt Fluffy_Pillow 47421.5/50000: 95% mana
4.8/5: 96% soul_shard
backdraft
2:47.700 havoc Q chaos_bolt Fluffy_Pillow 48335.0/50000: 97% mana
3.0/5: 60% soul_shard
2:50.308 havoc R incinerate Fluffy_Pillow 49639.0/50000: 99% mana
1.3/5: 26% soul_shard
2:52.049 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
2:53.355 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
2:54.662 aoe E channel_demonfire Fluffy_Pillow 49059.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
2:57.564 aoe I rain_of_fire Fluffy_Pillow 49760.0/50000: 100% mana
3.7/5: 74% soul_shard
backdraft
2:58.869 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
3:00.090 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
3:01.395 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
3:02.614 aoe F immolate enemy3 48765.0/50000: 98% mana
2.3/5: 46% soul_shard
3:03.921 cds M summon_infernal Fluffy_Pillow 48668.5/50000: 97% mana
2.4/5: 48% soul_shard
3:05.344 aoe L incinerate Fluffy_Pillow 48380.0/50000: 97% mana
2.9/5: 58% soul_shard
3:07.086 aoe D rain_of_fire Fluffy_Pillow 48251.0/50000: 97% mana
3.7/5: 74% soul_shard
3:08.393 aoe J conflagrate Fluffy_Pillow 48904.5/50000: 98% mana
1.1/5: 22% soul_shard
3:09.757 aoe L incinerate Fluffy_Pillow 49086.5/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
3:10.974 aoe L incinerate Fluffy_Pillow 48695.0/50000: 97% mana
2.6/5: 52% soul_shard
3:12.715 default 9 soul_fire Fluffy_Pillow 48565.5/50000: 97% mana
3.3/5: 66% soul_shard
3:16.192 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
3:17.935 aoe E channel_demonfire Fluffy_Pillow 49373.5/50000: 99% mana
5.0/5: 100% soul_shard
3:20.677 aoe H havoc enemy2 49994.5/50000: 100% mana
5.0/5: 100% soul_shard
3:21.984 havoc Q chaos_bolt Fluffy_Pillow 49648.0/50000: 99% mana
5.0/5: 100% soul_shard
3:24.593 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:25.899 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:27.728 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:29.035 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:30.342 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
3:32.168 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:33.476 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
3:35.216 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
3:36.522 aoe F immolate enemy3 49155.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
3:37.828 aoe K impending_catastrophe Fluffy_Pillow 49058.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
3:39.569 aoe E channel_demonfire Fluffy_Pillow 47928.5/50000: 96% mana
2.0/5: 40% soul_shard
backdraft
3:42.518 aoe F immolate Fluffy_Pillow 48653.0/50000: 97% mana
2.3/5: 46% soul_shard
backdraft
3:43.824 aoe F immolate enemy2 48556.0/50000: 97% mana
2.4/5: 48% soul_shard
backdraft
3:45.131 aoe L incinerate Fluffy_Pillow 48459.5/50000: 97% mana
2.6/5: 52% soul_shard
backdraft
3:46.351 aoe J conflagrate Fluffy_Pillow 48069.5/50000: 96% mana
2.8/5: 56% soul_shard
3:47.659 aoe I rain_of_fire Fluffy_Pillow 48223.5/50000: 96% mana
3.5/5: 70% soul_shard
backdraft
3:48.967 default A cataclysm Fluffy_Pillow 48877.5/50000: 98% mana
0.6/5: 12% soul_shard
backdraft
3:50.707 aoe H havoc enemy2 49247.5/50000: 98% mana
0.9/5: 18% soul_shard
backdraft
3:52.013 havoc R incinerate Fluffy_Pillow 48900.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
3:53.233 havoc N conflagrate Fluffy_Pillow 48510.5/50000: 97% mana
1.7/5: 34% soul_shard
3:54.541 havoc Q chaos_bolt Fluffy_Pillow 48664.5/50000: 97% mana
2.9/5: 58% soul_shard
backdraft
3:56.368 havoc R incinerate Fluffy_Pillow 49578.0/50000: 99% mana
1.2/5: 24% soul_shard
3:58.109 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
3:59.849 havoc Q chaos_bolt Fluffy_Pillow 48872.5/50000: 98% mana
2.6/5: 52% soul_shard
4:02.459 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
4:03.765 default 9 soul_fire Fluffy_Pillow 49252.0/50000: 99% mana
1.0/5: 20% soul_shard
4:07.243 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
4:10.043 aoe F immolate enemy2 49652.5/50000: 99% mana
2.6/5: 52% soul_shard
4:11.349 aoe F immolate enemy3 49252.0/50000: 99% mana
2.7/5: 54% soul_shard
4:12.654 aoe J conflagrate Fluffy_Pillow 49154.5/50000: 98% mana
2.8/5: 56% soul_shard
4:13.959 aoe I rain_of_fire Fluffy_Pillow 49307.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
4:15.266 aoe L incinerate Fluffy_Pillow 49960.5/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
4:16.486 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
4:17.793 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
4:19.012 aoe J conflagrate Fluffy_Pillow 48765.5/50000: 98% mana
1.9/5: 38% soul_shard
4:20.318 aoe L incinerate Fluffy_Pillow 48918.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
4:21.536 default A cataclysm Fluffy_Pillow 48527.5/50000: 97% mana
2.9/5: 58% soul_shard
4:23.276 aoe H havoc enemy2 48897.5/50000: 98% mana
3.3/5: 66% soul_shard
4:24.581 havoc Q chaos_bolt Fluffy_Pillow 48550.0/50000: 97% mana
3.4/5: 68% soul_shard
4:27.191 havoc N conflagrate Fluffy_Pillow 49855.0/50000: 100% mana
1.7/5: 34% soul_shard
4:28.496 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
4:30.323 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
4:32.064 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
4:33.803 havoc P immolate Fluffy_Pillow 48872.0/50000: 98% mana
2.6/5: 52% soul_shard
4:35.110 havoc N conflagrate Fluffy_Pillow 48775.5/50000: 98% mana
2.7/5: 54% soul_shard
4:36.417 aoe E channel_demonfire Fluffy_Pillow 48929.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
4:39.323 aoe I rain_of_fire Fluffy_Pillow 49632.0/50000: 99% mana
4.2/5: 84% soul_shard
backdraft
4:40.629 aoe K impending_catastrophe Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
backdraft
4:42.370 aoe F immolate enemy3 48002.5/50000: 96% mana
1.5/5: 30% soul_shard
backdraft
4:43.677 aoe L incinerate Fluffy_Pillow 47906.0/50000: 96% mana
1.6/5: 32% soul_shard
backdraft
4:44.898 aoe J conflagrate Fluffy_Pillow 47516.5/50000: 95% mana
2.0/5: 40% soul_shard
4:46.204 aoe L incinerate Fluffy_Pillow 47669.5/50000: 95% mana
2.6/5: 52% soul_shard
backdraft
4:47.424 aoe I rain_of_fire Fluffy_Pillow 47279.5/50000: 95% mana
3.0/5: 60% soul_shard
4:48.730 aoe L incinerate Fluffy_Pillow 47932.5/50000: 96% mana
0.1/5: 2% soul_shard
soothing_shade
4:50.471 aoe L incinerate Fluffy_Pillow 47803.0/50000: 96% mana
0.7/5: 14% soul_shard
soothing_shade
4:52.212 default 9 soul_fire Fluffy_Pillow 47673.5/50000: 95% mana
1.1/5: 22% soul_shard
soothing_shade
4:55.715 default A cataclysm Fluffy_Pillow 48425.0/50000: 97% mana
2.6/5: 52% soul_shard
soothing_shade
4:57.455 aoe H havoc enemy2 48795.0/50000: 98% mana
2.7/5: 54% soul_shard
soothing_shade
4:58.761 havoc N conflagrate Fluffy_Pillow 48448.0/50000: 97% mana
2.7/5: 54% soul_shard
soothing_shade
5:00.067 havoc Q chaos_bolt Fluffy_Pillow 48601.0/50000: 97% mana
4.1/5: 82% soul_shard
backdraft
5:01.894 havoc N conflagrate Fluffy_Pillow 49514.5/50000: 99% mana
2.1/5: 42% soul_shard
5:03.200 havoc Q chaos_bolt Fluffy_Pillow 49667.5/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
5:05.026 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
5:06.766 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
5:09.373 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
5:10.678 aoe E channel_demonfire Fluffy_Pillow 49251.5/50000: 99% mana
0.6/5: 12% soul_shard
5:13.542 aoe F immolate enemy2 49933.5/50000: 100% mana
0.8/5: 16% soul_shard
5:14.850 aoe J conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
0.8/5: 16% soul_shard
5:16.156 aoe F immolate enemy3 49406.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
5:17.462 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.6/5: 32% soul_shard
backdraft
5:18.683 aoe J conflagrate Fluffy_Pillow 48862.5/50000: 98% mana
2.1/5: 42% soul_shard
5:19.989 aoe F immolate Fluffy_Pillow 49015.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_Theotar"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=336239/infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_Theotar_Wprop : 9794 dps, 5228 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9794.3 9794.3 18.0 / 0.184% 881.7 / 9.0% 20.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
409.8 406.5 Mana 0.00% 38.1 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Theotar_Wprop 9794
Cataclysm 810 8.3% 9.7 32.46sec 25165 14811 Direct 29.0 7014 14042 8390 19.6%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.68 29.05 0.00 0.00 1.6992 0.0000 243664.43 243664.43 0.00% 14810.63 14810.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.43% 23.36 12 32 7014.30 6142 9232 7012.47 6610 7527 163855 163855 0.00%
crit 19.57% 5.69 0 13 14042.21 12287 18468 13952.30 0 16947 79810 79810 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.75
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1059) 0.0% (10.8%) 12.3 25.29sec 25898 9597

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.30 0.00 183.82 0.00 2.6985 0.1637 0.00 0.00 0.00% 9597.27 9597.27

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.30
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1059 10.8% 0.0 0.00sec 0 0 Direct 551.5 484 968 578 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 551.45 0.00 0.00 0.0000 0.0000 318456.65 318456.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 445.38 321 567 484.34 263 1241 484.72 452 525 215735 215735 0.00%
crit 19.23% 106.07 66 149 968.26 525 2469 968.88 820 1121 102721 102721 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1397 (1879) 14.3% (19.2%) 22.7 12.83sec 24813 12610 Direct 45.2 (90.1) 0 9271 9271 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.73 45.22 0.00 0.00 1.9677 0.0000 419288.73 419288.73 0.00% 12609.99 12609.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 45.22 34 60 9271.01 5864 15486 9271.70 8897 9940 419289 419289 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.82
  • if_expr:cast_time<havoc_remains
    Internal Combustion 482 4.9% 44.9 12.86sec 3224 0 Direct 44.9 2700 5387 3224 19.6%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.88 44.88 0.00 0.00 0.0000 0.0000 144718.34 144718.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.44% 36.10 25 50 2699.81 1 4484 2700.84 2476 2963 97464 97464 0.00%
crit 19.56% 8.78 1 20 5386.92 19 8968 5388.43 2685 6910 47254 47254 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 832 8.5% 37.2 7.94sec 6724 5379 Direct 55.9 3754 7481 4469 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.19 55.92 0.00 0.00 1.2500 0.0000 250074.77 250074.77 0.00% 5379.11 5379.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 45.14 31 60 3753.66 2048 6413 3754.82 3515 4067 169428 169428 0.00%
crit 19.28% 10.78 3 22 7480.70 4095 12814 7474.94 5401 9962 80647 80647 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.49
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.68
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1665 17.0% 28.2 10.21sec 17747 14041 Direct 35.2 1585 3162 1885 19.0%
Periodic 347.2 1048 2098 1251 19.3% 95.4%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.22 35.24 347.23 347.23 1.2640 2.4820 500814.64 500814.64 0.00% 558.01 14040.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.01% 28.55 16 42 1585.03 819 2515 1584.95 1430 1783 45241 45241 0.00%
crit 18.99% 6.69 0 15 3161.75 1640 4869 3149.82 0 4585 21163 21163 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.68% 280.13 216 346 1048.28 1 1603 1048.30 1019 1085 293645 293645 0.00%
crit 19.32% 67.10 37 102 2098.20 6 3206 2097.87 1963 2242 140766 140766 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.93
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.37
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (235) 0.0% (2.4%) 4.7 64.70sec 14988 9055

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.70 0.00 0.00 0.00 1.6554 0.0000 0.00 0.00 0.00% 9055.03 9055.03

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.74
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 33 0.3% 0.0 0.00sec 0 0 Direct 14.0 588 1176 699 18.8%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.99 0.00 0.00 0.0000 0.0000 9769.21 9769.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.16% 11.35 4 17 587.78 588 588 587.78 588 588 6672 6672 0.00%
crit 18.84% 2.63 0 9 1175.57 1176 1176 1130.57 0 1176 3097 3097 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 202 2.1% 0.0 0.00sec 0 0 Periodic 101.9 498 997 595 19.4% 18.2%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 101.95 101.95 0.0000 1.6136 60678.92 60678.92 0.00% 368.87 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.58% 82.15 62 108 498.44 446 514 498.45 495 502 40946 40946 0.00%
crit 19.42% 19.80 7 36 996.78 891 1029 996.84 968 1021 19732 19732 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 598 6.1% 41.9 6.59sec 4308 2944 Direct 52.7 (52.7) 2877 5774 3427 19.0% (19.0%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.91 52.67 0.00 0.00 1.4635 0.0000 180539.16 180539.16 0.00% 2943.69 2943.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.00% 42.66 23 62 2877.27 1335 4357 2879.08 2647 3139 122718 122718 0.00%
crit 19.00% 10.01 0 24 5773.53 2782 8713 5775.39 0 7009 57821 57821 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:30.97
    havoc
    [R]:11.20
  • if_expr:cast_time<havoc_remains
Rain of Fire 888 9.1% 16.4 17.77sec 16279 13036 Periodic 388.5 576 1153 688 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.41 0.00 0.00 388.47 1.2488 0.0000 267139.88 267139.88 0.00% 13036.30 13036.30
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.66% 313.32 187 434 576.24 507 762 576.25 558 602 180539 180539 0.00%
crit 19.34% 75.15 45 122 1152.56 1013 1524 1152.44 1106 1236 86600 86600 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.14
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.28
Soul Fire 513 5.2% 5.6 49.44sec 27667 7956 Direct 7.6 17229 34396 20435 18.7%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.58 7.55 0.00 0.00 3.4775 0.0000 154351.10 154351.10 0.00% 7956.24 7956.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.33% 6.14 2 9 17229.13 8605 26379 17261.31 14306 20755 105895 105895 0.00%
crit 18.67% 1.41 0 6 34396.29 17234 51105 25685.65 0 50870 48456 48456 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.65
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.03
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.8% 2.0 180.40sec 12119 10479 Direct 6.0 3348 6696 4043 20.7%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24237.93 24237.93 0.00% 10479.00 10479.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 4.76 2 6 3348.13 3348 3348 3348.13 3348 3348 15940 15940 0.00%
crit 20.65% 1.24 0 4 6696.27 6696 6696 4976.81 0 6696 8298 8298 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3544 / 716
Immolation 3276 6.7% 39.0 5.49sec 5040 0 Direct 117.0 1407 2813 1680 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 196547.12 196547.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 94.27 80 105 1406.74 1395 1469 1406.75 1401 1412 132614 132614 0.00%
crit 19.43% 22.73 12 37 2812.75 2790 2939 2812.55 2790 2850 63933 63933 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 268 0.5% 41.0 5.25sec 392 273 Direct 41.0 328 657 392 19.5%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16080.15 22968.89 29.99% 272.99 272.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.48% 33.00 26 39 328.09 326 343 328.09 326 329 10827 15465 29.99%
crit 19.52% 8.00 2 15 656.56 651 686 656.51 651 674 5254 7504 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 518 / 518
Firebolt 518 5.3% 93.6 3.21sec 1663 1142 Direct 92.9 1407 2813 1675 19.1%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.58 92.89 0.00 0.00 1.4562 0.0000 155648.85 155648.85 0.00% 1142.18 1142.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 75.13 50 96 1406.52 1395 1469 1406.51 1400 1411 105666 105666 0.00%
crit 19.12% 17.77 6 29 2813.49 2790 2939 2813.65 2790 2865 49983 49983 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:94.02
Simple Action Stats Execute Interval
Venthyr_Theotar_Wprop
Havoc 9.6 32.26sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.64 0.00 0.00 0.00 1.2442 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.65
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.2 0.0 8.0sec 8.0sec 4.4sec 53.89% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Venthyr_Theotar_Wprop
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.4s
  • trigger_min/max:1.9s / 23.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:53.89%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar_Wprop
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soothing Shade 4.1 0.0 64.3sec 64.3sec 11.8sec 15.99% 0.00% 0.0 (0.0) 3.9

Buff Details

  • buff initial source:Venthyr_Theotar_Wprop
  • cooldown name:buff_soothing_shade
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:525.00

Trigger Details

  • interval_min/max:20.0s / 201.7s
  • trigger_min/max:20.0s / 201.7s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s

Stack Uptimes

  • soothing_shade_1:15.99%

Spelldata

  • id:336885
  • name:Soothing Shade
  • tooltip:Standing in the shade makes it easier to focus, increasing your Mastery by $w1.
  • description:{$@spelldesc336239=Your spells and abilities have a chance to call Tubbins and Gubbins to your side for {$336808d=12 seconds}, parasol in hand. Standing in the shaded area grants you {$336885s1=525} Mastery.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Wasteland Propriety 4.7 0.0 64.7sec 64.7sec 9.8sec 15.38% 0.00% 0.0 (0.0) 4.6

Buff Details

  • buff initial source:Venthyr_Theotar_Wprop
  • cooldown name:buff_wasteland_propriety
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:61.7s / 85.3s
  • trigger_min/max:61.7s / 85.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.0s

Stack Uptimes

  • wasteland_propriety_1:15.38%

Spelldata

  • id:333218
  • name:Wasteland Propriety
  • tooltip:Versatility increased by $w1%. Delicious!
  • description:{$@spelldesc319983=$?a137005[Swarming Mist]?a212611[Sinful Brand]?a137009[Ravenous Frenzy]?a137014[Flayed Shot]?a137018[Mirrors of Torment]?a137022[Fallen Order]?a137026[Ashen Hallow]?a137030[Mindgames]?a137034[Flagellation]?a137038[Chain Harvest]?a137042[Impending Catastrophe]?a137047[Condemn][Activating your Venthyr class ability] signals the start of tea time, granting {$333218s1=6}% Versatility to you and {$333251s1=3}% Versatility to up to $333251i nearby allies. Lasts ${{$333218d=10 seconds}*$<mod>} sec.$?a137047|a137034[ You may only serve tea every {$333221d=60 seconds}.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar_Wprop_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.9s
  • trigger_min/max:180.0s / 182.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar_Wprop_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.9s
  • trigger_min/max:180.0s / 182.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 11.51% 8.18% 14.66% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Theotar_Wprop
soul_fire Soul Shard 6.59 7.24 7.72% 1.10 0.37 4.80%
immolate Soul Shard 347.21 33.49 35.71% 0.10 1.24 3.56%
incinerate Soul Shard 41.92 10.61 11.31% 0.25 0.00 0.03%
conflagrate Soul Shard 37.17 27.94 29.80% 0.75 0.00 0.00%
mana_regen Mana 658.17 122362.51 100.00% 185.91 27817.73 18.52%
immolate_crits Soul Shard 33.53 3.24 3.45% 0.10 0.12 3.49%
incinerate_crits Soul Shard 10.01 1.00 1.07% 0.10 0.00 0.05%
infernal Soul Shard 120.00 10.26 10.94% 0.09 1.74 14.48%
pet - imp
energy_regen Energy 362.19 3571.98 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 406.46 409.82 27853.4 48990.8 46951.5 50000.0
Soul Shard 4.0 0.31 0.31 3.5 2.1 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_Theotar_Wprop
cataclysm Mana 9.7 4845.3 500.0 500.4 50.3
channel_demonfire Mana 12.3 9224.0 750.0 750.1 34.5
chaos_bolt Soul Shard 22.7 45.4 2.0 2.0 12425.7
conflagrate Mana 37.2 18587.1 500.0 499.8 13.5
havoc Mana 9.6 9645.4 1000.0 1000.8 0.0
immolate Mana 28.2 21154.0 750.0 749.6 23.7
impending_catastrophe Mana 4.7 9415.2 2000.0 2003.2 7.5
incinerate Mana 41.9 41919.1 1000.0 1000.3 4.3
rain_of_fire Soul Shard 16.4 49.3 3.0 3.0 5423.1
soul_fire Mana 6.6 6586.3 1000.0 1180.6 23.4
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 93.6 3742.8 40.0 40.0 41.6

Statistics & Data Analysis

Fight Length
Venthyr_Theotar_Wprop Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
Venthyr_Theotar_Wprop Damage Per Second
Count 627
Mean 9794.25
Minimum 9212.98
Maximum 10468.35
Spread ( max - min ) 1255.37
Range [ ( max - min ) / 2 * 100% ] 6.41%
Standard Deviation 230.4590
5th Percentile 9447.29
95th Percentile 10207.99
( 95th Percentile - 5th Percentile ) 760.70
Mean Distribution
Standard Deviation 9.2036
95.00% Confidence Interval ( 9776.21 - 9812.29 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2127
0.1 Scale Factor Error with Delta=300 454
0.05 Scale Factor Error with Delta=300 1814
0.01 Scale Factor Error with Delta=300 45339
Priority Target DPS
Venthyr_Theotar_Wprop Priority Target Damage Per Second
Count 627
Mean 5228.09
Minimum 4841.37
Maximum 5728.79
Spread ( max - min ) 887.42
Range [ ( max - min ) / 2 * 100% ] 8.49%
Standard Deviation 136.5957
5th Percentile 5020.51
95th Percentile 5463.83
( 95th Percentile - 5th Percentile ) 443.31
Mean Distribution
Standard Deviation 5.4551
95.00% Confidence Interval ( 5217.40 - 5238.78 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2623
0.1 Scale Factor Error with Delta=300 160
0.05 Scale Factor Error with Delta=300 638
0.01 Scale Factor Error with Delta=300 15928
DPS(e)
Venthyr_Theotar_Wprop Damage Per Second (Effective)
Count 627
Mean 9794.25
Minimum 9212.98
Maximum 10468.35
Spread ( max - min ) 1255.37
Range [ ( max - min ) / 2 * 100% ] 6.41%
Damage
Venthyr_Theotar_Wprop Damage
Count 627
Mean 2573733.77
Minimum 2030841.21
Maximum 3114412.79
Spread ( max - min ) 1083571.57
Range [ ( max - min ) / 2 * 100% ] 21.05%
DTPS
Venthyr_Theotar_Wprop Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Theotar_Wprop Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Theotar_Wprop Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Theotar_Wprop Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Theotar_Wprop Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Theotar_Wprop Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_Theotar_WpropTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Theotar_Wprop Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.65 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.75 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.14 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.30 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.93 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.65 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.28 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.49 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.74 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 30.97 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.68 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.03 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.37 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.82 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.20 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFDKLJLJDLALJEHQQRNOFFIFJIELJLALLHNQQPNQELFFFJKLI9AHNQNQRRPEFJIFLJLLLIJAHRRQRNP9EIFJKLIJLLAHNQRQRNPEFIFLMJLLD9AHQNQNQNPDEFIFJKLLJLIAHRNQRRP9EIFJLJILLLJAHQRNQRPEJLLIFKJLFL9AEHQNQNPQLJLFILEF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.032 cds M summon_infernal Fluffy_Pillow 49766.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.038 aoe H havoc enemy2 49269.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.045 havoc Q chaos_bolt Fluffy_Pillow 48772.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:08.055 havoc N conflagrate Fluffy_Pillow 49777.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:09.063 havoc Q chaos_bolt Fluffy_Pillow 49781.5/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.469 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:11.476 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:12.482 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:13.890 havoc N conflagrate Fluffy_Pillow 49956.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:14.895 havoc Q chaos_bolt Fluffy_Pillow 49958.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:16.301 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:17.309 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
bloodlust, backdraft
0:18.315 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:20.685 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:21.691 aoe F immolate enemy2 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:22.697 aoe F immolate enemy3 49005.0/50000: 98% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:23.703 aoe D rain_of_fire Fluffy_Pillow 48758.0/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:24.710 aoe K impending_catastrophe Fluffy_Pillow 49261.5/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft
0:26.051 aoe L incinerate Fluffy_Pillow 47932.0/50000: 96% mana
1.0/5: 20% soul_shard
bloodlust, backdraft, wasteland_propriety
0:26.990 aoe J conflagrate Fluffy_Pillow 47401.5/50000: 95% mana
1.4/5: 28% soul_shard
bloodlust, wasteland_propriety
0:27.996 aoe L incinerate Fluffy_Pillow 47404.5/50000: 95% mana
2.3/5: 46% soul_shard
bloodlust, backdraft, wasteland_propriety
0:28.936 aoe J conflagrate Fluffy_Pillow 46874.5/50000: 94% mana
2.8/5: 56% soul_shard
bloodlust, wasteland_propriety
0:29.943 aoe D rain_of_fire Fluffy_Pillow 46878.0/50000: 94% mana
3.7/5: 74% soul_shard
bloodlust, backdraft, wasteland_propriety
0:30.948 aoe L incinerate Fluffy_Pillow 47380.5/50000: 95% mana
1.1/5: 22% soul_shard
bloodlust, backdraft, wasteland_propriety
0:31.887 default A cataclysm Fluffy_Pillow 46850.0/50000: 94% mana
1.7/5: 34% soul_shard
bloodlust, wasteland_propriety
0:33.227 aoe L incinerate Fluffy_Pillow 47020.0/50000: 94% mana
2.1/5: 42% soul_shard
bloodlust, wasteland_propriety
0:34.568 aoe J conflagrate Fluffy_Pillow 46690.5/50000: 93% mana
2.8/5: 56% soul_shard
bloodlust, wasteland_propriety
0:35.676 aoe E channel_demonfire Fluffy_Pillow 46744.5/50000: 93% mana
3.4/5: 68% soul_shard
bloodlust, backdraft, wasteland_propriety
0:37.858 aoe H havoc enemy2 47085.5/50000: 94% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:38.864 havoc Q chaos_bolt Fluffy_Pillow 46588.5/50000: 93% mana
4.1/5: 82% soul_shard
bloodlust, backdraft
0:40.271 havoc Q chaos_bolt Fluffy_Pillow 47292.0/50000: 95% mana
2.3/5: 46% soul_shard
bloodlust
0:42.278 havoc R incinerate Fluffy_Pillow 48295.5/50000: 97% mana
0.6/5: 12% soul_shard
0:44.020 havoc N conflagrate Fluffy_Pillow 48166.5/50000: 96% mana
1.1/5: 22% soul_shard
0:45.327 havoc O soul_fire Fluffy_Pillow 48320.0/50000: 97% mana
2.4/5: 48% soul_shard
backdraft
0:48.803 aoe F immolate enemy2 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:50.111 aoe F immolate Fluffy_Pillow 48905.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:51.418 aoe I rain_of_fire Fluffy_Pillow 48809.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:52.725 aoe F immolate enemy3 49462.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
0:54.031 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.3/5: 46% soul_shard
0:55.338 aoe I rain_of_fire Fluffy_Pillow 49405.5/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
0:56.644 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.1/5: 2% soul_shard
backdraft
0:59.402 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
1:00.620 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
0.8/5: 16% soul_shard
1:01.928 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
1:03.147 default A cataclysm Fluffy_Pillow 48765.0/50000: 98% mana
1.8/5: 36% soul_shard
soothing_shade
1:04.963 aoe L incinerate Fluffy_Pillow 49173.0/50000: 98% mana
2.0/5: 40% soul_shard
soothing_shade
1:06.704 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.6/5: 52% soul_shard
soothing_shade
1:08.445 aoe H havoc enemy2 48873.0/50000: 98% mana
3.1/5: 62% soul_shard
soothing_shade
1:09.751 havoc N conflagrate Fluffy_Pillow 48526.0/50000: 97% mana
3.2/5: 64% soul_shard
soothing_shade
1:11.057 havoc Q chaos_bolt Fluffy_Pillow 48679.0/50000: 97% mana
4.6/5: 92% soul_shard
backdraft, soothing_shade
1:12.884 havoc Q chaos_bolt Fluffy_Pillow 49592.5/50000: 99% mana
2.7/5: 54% soul_shard
soothing_shade
1:15.494 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
1:16.800 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.3/5: 26% soul_shard
1:18.108 havoc Q chaos_bolt Fluffy_Pillow 49406.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
1:19.936 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:22.772 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
1:24.513 aoe F immolate enemy3 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
1:25.820 aoe F immolate Fluffy_Pillow 48906.0/50000: 98% mana
1.4/5: 28% soul_shard
1:27.126 aoe F immolate enemy2 48809.0/50000: 98% mana
1.7/5: 34% soul_shard
1:28.434 aoe J conflagrate Fluffy_Pillow 48713.0/50000: 97% mana
1.7/5: 34% soul_shard
1:29.740 aoe K impending_catastrophe Fluffy_Pillow 48866.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:31.480 aoe L incinerate Fluffy_Pillow 47736.0/50000: 95% mana
2.7/5: 54% soul_shard
backdraft, wasteland_propriety
1:32.700 aoe I rain_of_fire Fluffy_Pillow 47346.0/50000: 95% mana
3.2/5: 64% soul_shard
wasteland_propriety
1:34.007 default 9 soul_fire Fluffy_Pillow 47999.5/50000: 96% mana
0.3/5: 6% soul_shard
wasteland_propriety
1:37.485 default A cataclysm Fluffy_Pillow 48738.5/50000: 97% mana
1.8/5: 36% soul_shard
wasteland_propriety
1:39.226 aoe H havoc enemy2 49109.0/50000: 98% mana
2.0/5: 40% soul_shard
wasteland_propriety
1:40.532 havoc N conflagrate Fluffy_Pillow 48762.0/50000: 98% mana
2.2/5: 44% soul_shard
wasteland_propriety
1:41.838 havoc Q chaos_bolt Fluffy_Pillow 48915.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:43.665 havoc N conflagrate Fluffy_Pillow 49828.5/50000: 100% mana
1.5/5: 30% soul_shard
1:44.972 havoc Q chaos_bolt Fluffy_Pillow 49982.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
1:46.799 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
1:48.537 havoc R incinerate Fluffy_Pillow 49001.0/50000: 98% mana
1.6/5: 32% soul_shard
1:50.276 havoc P immolate Fluffy_Pillow 48870.5/50000: 98% mana
2.2/5: 44% soul_shard
1:51.583 aoe E channel_demonfire Fluffy_Pillow 48774.0/50000: 98% mana
2.3/5: 46% soul_shard
1:54.456 aoe F immolate enemy2 49460.5/50000: 99% mana
2.7/5: 54% soul_shard
1:55.762 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.9/5: 58% soul_shard
soothing_shade
1:57.068 aoe I rain_of_fire Fluffy_Pillow 49405.0/50000: 99% mana
3.4/5: 68% soul_shard
backdraft, soothing_shade
1:58.376 aoe F immolate enemy3 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, soothing_shade
1:59.682 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
backdraft, soothing_shade
2:00.901 aoe J conflagrate Fluffy_Pillow 48861.5/50000: 98% mana
1.1/5: 22% soul_shard
soothing_shade
2:02.207 aoe L incinerate Fluffy_Pillow 49014.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft, soothing_shade
2:03.426 aoe L incinerate Fluffy_Pillow 48624.0/50000: 97% mana
2.1/5: 42% soul_shard
soothing_shade
2:05.167 aoe L incinerate Fluffy_Pillow 48494.5/50000: 97% mana
2.5/5: 50% soul_shard
soothing_shade
2:06.906 aoe I rain_of_fire Fluffy_Pillow 48364.0/50000: 97% mana
3.1/5: 62% soul_shard
2:08.212 aoe J conflagrate Fluffy_Pillow 49017.0/50000: 98% mana
0.2/5: 4% soul_shard
2:09.519 default A cataclysm Fluffy_Pillow 49170.5/50000: 98% mana
0.9/5: 18% soul_shard
backdraft
2:11.259 aoe H havoc enemy2 49502.0/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
2:12.566 havoc R incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
2:13.786 havoc R incinerate Fluffy_Pillow 48765.5/50000: 98% mana
1.7/5: 34% soul_shard
2:15.525 havoc Q chaos_bolt Fluffy_Pillow 48635.0/50000: 97% mana
2.5/5: 50% soul_shard
2:18.135 havoc R incinerate Fluffy_Pillow 49940.0/50000: 100% mana
0.8/5: 16% soul_shard
2:19.877 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.5/5: 30% soul_shard
2:21.185 havoc P immolate Fluffy_Pillow 49157.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:22.492 default 9 soul_fire Fluffy_Pillow 49060.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
2:25.969 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
4.5/5: 90% soul_shard
backdraft
2:28.822 aoe I rain_of_fire Fluffy_Pillow 49678.5/50000: 99% mana
4.8/5: 96% soul_shard
backdraft
2:30.130 aoe F immolate enemy3 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
2:31.437 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.1/5: 42% soul_shard
2:32.743 aoe K impending_catastrophe Fluffy_Pillow 49405.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
2:34.483 aoe L incinerate Fluffy_Pillow 48002.0/50000: 96% mana
2.9/5: 58% soul_shard
backdraft, wasteland_propriety
2:35.703 aoe I rain_of_fire Fluffy_Pillow 47612.0/50000: 95% mana
3.3/5: 66% soul_shard
wasteland_propriety
2:37.009 aoe J conflagrate Fluffy_Pillow 48265.0/50000: 97% mana
0.4/5: 8% soul_shard
wasteland_propriety
2:38.316 aoe L incinerate Fluffy_Pillow 48418.5/50000: 97% mana
1.1/5: 22% soul_shard
backdraft, wasteland_propriety
2:39.534 aoe L incinerate Fluffy_Pillow 48027.5/50000: 96% mana
1.5/5: 30% soul_shard
wasteland_propriety
2:41.274 default A cataclysm Fluffy_Pillow 47897.5/50000: 96% mana
2.1/5: 42% soul_shard
wasteland_propriety
2:43.014 aoe H havoc enemy2 48267.5/50000: 97% mana
2.4/5: 48% soul_shard
wasteland_propriety
2:44.320 havoc N conflagrate Fluffy_Pillow 47920.5/50000: 96% mana
2.5/5: 50% soul_shard
wasteland_propriety
2:45.624 havoc Q chaos_bolt Fluffy_Pillow 48072.5/50000: 96% mana
3.7/5: 74% soul_shard
backdraft
2:47.451 havoc R incinerate Fluffy_Pillow 48986.0/50000: 98% mana
1.8/5: 36% soul_shard
2:49.191 havoc Q chaos_bolt Fluffy_Pillow 48856.0/50000: 98% mana
2.4/5: 48% soul_shard
2:51.800 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
2:53.542 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.6/5: 32% soul_shard
2:54.848 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:56.154 aoe E channel_demonfire Fluffy_Pillow 49059.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:59.001 aoe F immolate enemy2 49732.5/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
3:00.308 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
3:01.615 aoe F immolate enemy3 49906.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
3:02.923 aoe L incinerate Fluffy_Pillow 49253.0/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
3:04.141 cds M summon_infernal Fluffy_Pillow 48862.0/50000: 98% mana
0.7/5: 14% soul_shard
3:05.447 aoe J conflagrate Fluffy_Pillow 48515.0/50000: 97% mana
1.0/5: 20% soul_shard
3:06.754 aoe L incinerate Fluffy_Pillow 48668.5/50000: 97% mana
2.0/5: 40% soul_shard
backdraft
3:07.974 aoe L incinerate Fluffy_Pillow 48278.5/50000: 97% mana
2.5/5: 50% soul_shard
3:09.715 aoe D rain_of_fire Fluffy_Pillow 48149.0/50000: 96% mana
3.4/5: 68% soul_shard
3:11.021 default 9 soul_fire Fluffy_Pillow 48802.0/50000: 98% mana
0.9/5: 18% soul_shard
3:14.498 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
3.3/5: 66% soul_shard
3:16.238 aoe H havoc enemy2 49372.0/50000: 99% mana
3.9/5: 78% soul_shard
3:17.544 havoc Q chaos_bolt Fluffy_Pillow 49025.0/50000: 98% mana
4.1/5: 82% soul_shard
3:20.153 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:21.459 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:23.287 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:24.593 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:26.420 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:27.727 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:29.033 aoe D rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
3:30.340 aoe E channel_demonfire Fluffy_Pillow 49905.5/50000: 100% mana
2.0/5: 40% soul_shard
backdraft
3:33.172 aoe F immolate enemy2 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
3:34.479 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft, soothing_shade
3:35.786 aoe F immolate enemy3 49906.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft, soothing_shade
3:37.093 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
0.5/5: 10% soul_shard
soothing_shade
3:38.400 aoe K impending_catastrophe Fluffy_Pillow 49406.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft, soothing_shade
3:40.141 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
1.3/5: 26% soul_shard
backdraft, soothing_shade, wasteland_propriety
3:41.360 aoe L incinerate Fluffy_Pillow 47612.0/50000: 95% mana
1.5/5: 30% soul_shard
soothing_shade, wasteland_propriety
3:43.101 aoe J conflagrate Fluffy_Pillow 47482.5/50000: 95% mana
2.1/5: 42% soul_shard
soothing_shade, wasteland_propriety
3:44.409 aoe L incinerate Fluffy_Pillow 47636.5/50000: 95% mana
2.7/5: 54% soul_shard
backdraft, soothing_shade, wasteland_propriety
3:45.628 aoe I rain_of_fire Fluffy_Pillow 47246.0/50000: 94% mana
3.1/5: 62% soul_shard
soothing_shade, wasteland_propriety
3:46.934 default A cataclysm Fluffy_Pillow 47899.0/50000: 96% mana
0.2/5: 4% soul_shard
wasteland_propriety
3:48.676 aoe H havoc enemy2 48270.0/50000: 97% mana
0.5/5: 10% soul_shard
wasteland_propriety
3:49.983 havoc R incinerate Fluffy_Pillow 47923.5/50000: 96% mana
0.6/5: 12% soul_shard
wasteland_propriety
3:51.724 havoc N conflagrate Fluffy_Pillow 47794.0/50000: 96% mana
1.2/5: 24% soul_shard
3:53.031 havoc Q chaos_bolt Fluffy_Pillow 47947.5/50000: 96% mana
2.6/5: 52% soul_shard
backdraft
3:54.858 havoc R incinerate Fluffy_Pillow 48861.0/50000: 98% mana
0.9/5: 18% soul_shard
3:56.599 havoc R incinerate Fluffy_Pillow 48731.5/50000: 97% mana
1.6/5: 32% soul_shard
3:58.340 havoc P immolate Fluffy_Pillow 48602.0/50000: 97% mana
2.2/5: 44% soul_shard
3:59.647 default 9 soul_fire Fluffy_Pillow 48505.5/50000: 97% mana
2.3/5: 46% soul_shard
4:03.124 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
3.7/5: 74% soul_shard
4:05.927 aoe I rain_of_fire Fluffy_Pillow 49653.5/50000: 99% mana
4.1/5: 82% soul_shard
4:07.234 aoe F immolate enemy3 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
4:08.539 aoe J conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
1.4/5: 28% soul_shard
4:09.846 aoe L incinerate Fluffy_Pillow 49405.0/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
4:11.065 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.4/5: 48% soul_shard
4:12.371 aoe I rain_of_fire Fluffy_Pillow 49155.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
4:13.677 aoe L incinerate Fluffy_Pillow 49808.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
4:14.896 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.6/5: 12% soul_shard
4:16.637 aoe L incinerate Fluffy_Pillow 48872.5/50000: 98% mana
1.1/5: 22% soul_shard
4:18.378 aoe J conflagrate Fluffy_Pillow 48743.0/50000: 97% mana
1.5/5: 30% soul_shard
4:19.684 default A cataclysm Fluffy_Pillow 48896.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
4:21.425 aoe H havoc enemy2 49266.5/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
4:22.733 havoc Q chaos_bolt Fluffy_Pillow 48920.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:24.562 havoc R incinerate Fluffy_Pillow 49835.0/50000: 100% mana
0.8/5: 16% soul_shard
4:26.302 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
4:27.610 havoc Q chaos_bolt Fluffy_Pillow 49156.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
4:29.438 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
4:31.180 havoc P immolate Fluffy_Pillow 49003.0/50000: 98% mana
1.4/5: 28% soul_shard
4:32.487 aoe E channel_demonfire Fluffy_Pillow 48906.5/50000: 98% mana
1.4/5: 28% soul_shard
4:35.304 aoe J conflagrate Fluffy_Pillow 49565.0/50000: 99% mana
1.7/5: 34% soul_shard
4:36.611 aoe L incinerate Fluffy_Pillow 49718.5/50000: 99% mana
2.4/5: 48% soul_shard
backdraft
4:37.831 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.8/5: 56% soul_shard
4:39.570 aoe I rain_of_fire Fluffy_Pillow 48872.0/50000: 98% mana
3.2/5: 64% soul_shard
4:40.876 aoe F immolate enemy3 49525.0/50000: 99% mana
0.4/5: 8% soul_shard
4:42.184 aoe K impending_catastrophe Fluffy_Pillow 49253.0/50000: 99% mana
0.6/5: 12% soul_shard
soothing_shade
4:43.926 aoe J conflagrate Fluffy_Pillow 48003.0/50000: 96% mana
0.8/5: 16% soul_shard
soothing_shade, wasteland_propriety
4:45.231 aoe L incinerate Fluffy_Pillow 48155.5/50000: 96% mana
1.4/5: 28% soul_shard
backdraft, soothing_shade, wasteland_propriety
4:46.451 aoe F immolate enemy2 47765.5/50000: 96% mana
1.8/5: 36% soul_shard
soothing_shade, wasteland_propriety
4:47.757 aoe L incinerate Fluffy_Pillow 47668.5/50000: 95% mana
1.9/5: 38% soul_shard
soothing_shade, wasteland_propriety
4:49.498 default 9 soul_fire Fluffy_Pillow 47539.0/50000: 95% mana
2.4/5: 48% soul_shard
soothing_shade, wasteland_propriety
4:52.977 default A cataclysm Fluffy_Pillow 48278.5/50000: 97% mana
3.8/5: 76% soul_shard
soothing_shade, wasteland_propriety
4:54.716 aoe E channel_demonfire Fluffy_Pillow 48648.0/50000: 97% mana
4.0/5: 80% soul_shard
4:57.424 aoe H havoc enemy2 49252.0/50000: 99% mana
4.3/5: 86% soul_shard
4:58.732 havoc Q chaos_bolt Fluffy_Pillow 48906.0/50000: 98% mana
4.4/5: 88% soul_shard
5:01.343 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
5:02.651 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
backdraft
5:04.479 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
5:05.788 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft
5:07.092 havoc Q chaos_bolt Fluffy_Pillow 49251.0/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
5:08.920 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
5:10.660 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
5:11.967 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
5:13.185 aoe F immolate enemy3 48764.5/50000: 98% mana
3.2/5: 64% soul_shard
5:14.491 aoe I rain_of_fire Fluffy_Pillow 48667.5/50000: 97% mana
3.3/5: 66% soul_shard
5:15.798 aoe L incinerate Fluffy_Pillow 49321.0/50000: 99% mana
0.5/5: 10% soul_shard
5:17.538 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
5:20.272 aoe F immolate enemy2 49619.0/50000: 99% mana
1.1/5: 22% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_Theotar_Wprop"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=336239/319983/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

destruction : 9246 dps, 4981 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9246.2 9246.2 15.8 / 0.171% 726.4 / 7.9% 20.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
395.4 392.6 Mana 0.00% 38.2 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
destruction 9246
Cataclysm 772 8.4% 9.7 32.49sec 23962 14102 Direct 29.1 6699 13427 7987 19.1%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.69 29.08 0.00 0.00 1.6992 0.0000 232244.61 232244.61 0.00% 14101.93 14101.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.85% 23.51 15 35 6698.90 6141 7260 6698.77 6537 6914 157483 157483 0.00%
crit 19.15% 5.57 0 15 13427.46 12285 14521 13399.69 0 14347 74762 74762 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.76
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1031) 0.0% (11.2%) 12.3 25.16sec 25146 9322

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.34 0.00 184.20 0.00 2.6975 0.1637 0.00 0.00 0.00% 9322.12 9322.12

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.34
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1031 11.2% 0.0 0.00sec 0 0 Direct 552.6 471 941 561 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 552.59 0.00 0.00 0.0000 0.0000 310212.18 310212.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 446.08 278 563 470.85 263 976 471.09 448 500 210021 210021 0.00%
crit 19.28% 106.52 70 153 940.51 525 1952 941.25 816 1097 100191 100191 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1252 (1708) 13.5% (18.5%) 22.2 13.24sec 23124 11743 Direct 44.1 (87.7) 0 8526 8526 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.18 44.11 0.00 0.00 1.9691 0.0000 376137.42 376137.42 0.00% 11743.26 11743.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.11 32 58 8526.49 5861 11548 8526.18 8310 8698 376137 376137 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [P]:22.27
  • if_expr:cast_time<havoc_remains
    Internal Combustion 456 4.9% 43.6 13.22sec 3137 0 Direct 43.6 2631 5280 3137 19.1%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.58 43.58 0.00 0.00 0.0000 0.0000 136714.14 136714.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 35.24 22 49 2630.79 1 3715 2633.10 2410 2839 92705 92705 0.00%
crit 19.13% 8.34 2 18 5279.71 5 7428 5280.13 3803 6419 44009 44009 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 806 8.7% 37.2 7.93sec 6524 5219 Direct 56.3 3598 7200 4306 19.6%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.16 56.30 0.00 0.00 1.2500 0.0000 242465.29 242465.29 0.00% 5219.36 5219.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.36% 45.25 31 61 3598.22 2047 5042 3597.18 3335 3904 162793 162793 0.00%
crit 19.64% 11.06 3 23 7200.29 4095 10084 7202.97 5611 9377 79672 79672 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.09
  • if_expr:buff.backdraft.down
    havoc
    [M]:19.07
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1613 17.5% 28.1 10.37sec 17251 13650 Direct 35.2 1536 3058 1837 19.7%
Periodic 347.9 1014 2029 1209 19.2% 95.6%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.12 35.15 347.86 347.86 1.2638 2.4821 485187.88 485187.88 0.00% 539.71 13650.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.32% 28.23 18 40 1536.29 819 2017 1536.60 1425 1666 43372 43372 0.00%
crit 19.68% 6.92 1 16 3058.30 1638 4034 3052.78 2233 3763 21155 21155 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.75% 280.91 209 347 1013.82 0 1261 1013.92 992 1037 284797 284797 0.00%
crit 19.25% 66.95 41 97 2029.26 3 2521 2029.63 1912 2174 135864 135864 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.77
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:8.46
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 607 6.6% 47.0 5.87sec 3888 2631 Direct 58.2 (58.2) 2633 5267 3139 19.2% (19.2%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 47.02 58.24 0.00 0.00 1.4779 0.0000 182812.29 182812.29 0.00% 2630.58 2630.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 47.07 28 71 2633.40 1312 3232 2634.41 2492 2820 123937 123937 0.00%
crit 19.19% 11.18 3 25 5266.94 2625 6464 5268.35 4042 6153 58875 58875 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [K]:35.63
    havoc
    [Q]:11.65
  • if_expr:cast_time<havoc_remains
Rain of Fire 894 9.7% 17.2 16.72sec 15670 12590 Periodic 406.9 553 1106 660 19.5% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.15 0.00 0.00 406.92 1.2447 0.0000 268791.78 268791.78 0.00% 12590.37 12590.37
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.50% 327.57 218 471 552.71 507 599 552.71 545 560 181054 181054 0.00%
crit 19.50% 79.36 48 122 1105.62 1013 1198 1105.56 1084 1127 87738 87738 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.17
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.98
Soul Fire 512 5.5% 5.6 49.60sec 27581 7931 Direct 7.6 16948 34010 20210 19.1%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.58 7.61 0.00 0.00 3.4775 0.0000 153783.01 153783.01 0.00% 7931.46 7931.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.89% 6.16 2 10 16947.95 8665 21175 16964.04 14373 19484 104317 104317 0.00%
crit 19.11% 1.45 0 5 34010.32 17989 42348 27532.09 0 42316 49466 49466 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.59
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [N]:1.08
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.9% 2.0 180.55sec 11996 10377 Direct 6.0 3348 6696 3999 19.4%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1564 0.0000 23992.30 23992.30 0.00% 10377.29 10377.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 4.83 2 6 3348.13 3348 3348 3348.13 3348 3348 16185 16185 0.00%
crit 19.43% 1.17 0 4 6696.27 6696 6696 4859.33 0 6696 7807 7807 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [L]:2.00
pet - infernal 3509 / 709
Immolation 3243 7.0% 39.0 5.49sec 4989 0 Direct 117.0 1395 2790 1663 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194586.98 194586.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 94.52 82 107 1395.06 1395 1395 1395.06 1395 1395 131856 131856 0.00%
crit 19.22% 22.48 10 35 2790.11 2790 2790 2790.11 2790 2790 62731 62731 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.6% 41.0 5.25sec 389 271 Direct 41.0 326 651 389 19.6%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15961.40 22799.27 29.99% 270.97 270.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.42% 32.97 25 41 325.55 326 326 325.55 326 326 10734 15332 29.99%
crit 19.58% 8.03 0 16 651.10 651 651 650.07 0 651 5228 7467 29.94%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 513 / 513
Firebolt 513 5.6% 93.6 3.21sec 1651 1134 Direct 92.9 1395 2790 1663 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.58 92.89 0.00 0.00 1.4562 0.0000 154473.00 154473.00 0.00% 1133.55 1133.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 75.06 53 94 1395.06 1395 1395 1395.06 1395 1395 104709 104709 0.00%
crit 19.20% 17.84 5 33 2790.11 2790 2790 2790.11 2790 2790 49764 49764 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:94.02
Simple Action Stats Execute Interval
destruction
Havoc 9.6 32.37sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.63 0.00 0.00 0.00 1.2441 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.62
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.2 0.0 8.0sec 8.0sec 4.1sec 50.89% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 23.3s
  • trigger_min/max:2.1s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.89%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.47% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.47%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:destruction_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.6s
  • trigger_min/max:180.0s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:destruction_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.6s
  • trigger_min/max:180.0s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 12.98% 10.02% 15.71% 0.8s 0.0s 6.5s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
destruction
soul_fire Soul Shard 6.58 7.23 7.60% 1.10 0.43 5.62%
immolate Soul Shard 347.84 33.42 35.17% 0.10 1.36 3.92%
incinerate Soul Shard 47.03 11.72 12.33% 0.25 0.00 0.03%
conflagrate Soul Shard 37.15 28.13 29.61% 0.76 0.00 0.00%
mana_regen Mana 658.63 118163.60 100.00% 179.41 32015.66 21.32%
immolate_crits Soul Shard 33.71 3.23 3.40% 0.10 0.14 4.05%
incinerate_crits Soul Shard 11.19 1.12 1.18% 0.10 0.00 0.03%
infernal Soul Shard 120.00 10.16 10.70% 0.08 1.84 15.31%
pet - imp
energy_regen Energy 362.19 3571.98 100.00% 9.86 22.74 0.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 392.56 395.36 32032.4 49157.8 47765.5 50000.0
Soul Shard 4.0 0.32 0.32 3.8 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
destruction
cataclysm Mana 9.7 4849.9 500.0 500.4 47.9
channel_demonfire Mana 12.3 9251.9 750.0 750.0 33.5
chaos_bolt Soul Shard 22.2 44.3 2.0 2.0 11571.5
conflagrate Mana 37.1 18574.7 500.0 499.8 13.1
havoc Mana 9.6 9622.1 1000.0 999.7 0.0
immolate Mana 28.1 21088.6 750.0 749.8 23.0
incinerate Mana 47.0 47032.7 1000.0 1000.2 3.9
rain_of_fire Soul Shard 17.1 51.4 3.0 3.0 5224.5
soul_fire Mana 6.6 6583.2 1000.0 1180.7 23.4
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.6 3742.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
destruction Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
destruction Damage Per Second
Count 627
Mean 9246.18
Minimum 8802.73
Maximum 9805.93
Spread ( max - min ) 1003.20
Range [ ( max - min ) / 2 * 100% ] 5.42%
Standard Deviation 202.4363
5th Percentile 8940.84
95th Percentile 9601.44
( 95th Percentile - 5th Percentile ) 660.60
Mean Distribution
Standard Deviation 8.0845
95.00% Confidence Interval ( 9230.33 - 9262.02 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1842
0.1 Scale Factor Error with Delta=300 350
0.05 Scale Factor Error with Delta=300 1400
0.01 Scale Factor Error with Delta=300 34984
Priority Target DPS
destruction Priority Target Damage Per Second
Count 627
Mean 4980.80
Minimum 4667.99
Maximum 5480.20
Spread ( max - min ) 812.21
Range [ ( max - min ) / 2 * 100% ] 8.15%
Standard Deviation 119.7385
5th Percentile 4792.41
95th Percentile 5167.78
( 95th Percentile - 5th Percentile ) 375.37
Mean Distribution
Standard Deviation 4.7819
95.00% Confidence Interval ( 4971.43 - 4990.17 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2221
0.1 Scale Factor Error with Delta=300 123
0.05 Scale Factor Error with Delta=300 490
0.01 Scale Factor Error with Delta=300 12240
DPS(e)
destruction Damage Per Second (Effective)
Count 627
Mean 9246.18
Minimum 8802.73
Maximum 9805.93
Spread ( max - min ) 1003.20
Range [ ( max - min ) / 2 * 100% ] 5.42%
Damage
destruction Damage
Count 627
Mean 2412340.89
Minimum 1918377.00
Maximum 2892038.06
Spread ( max - min ) 973661.06
Range [ ( max - min ) / 2 * 100% ] 20.18%
DTPS
destruction Damage Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
destruction Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
destruction Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
destruction Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
destruction Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
destruction Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
destructionTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
destruction Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.59 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.76 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.17 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.34 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.77 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.62 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.98 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.09 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 35.63 incinerate
actions.cds
# count action,conditions
L 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
M 19.07 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
N 1.08 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
O 8.46 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
P 22.27 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
Q 11.65 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AELHPMPMOPMPMDEFFFDKJKKDJKAKIEHMPQMONIKJFIEKJKKAKIHQMPQMOQEIFJKKKKJ9AHPMPPOQMEKIFFJFKKKIAHQMPQMPO9EFFJIKJKKKAHMPPQMOEKIJKFLKJDKK9AEHPMPMOPDJKKFFEFIJKAKHMPQPOQM9EFIJKJIKAHQMPQPOEJKKFJFIKKKJA9EHPMPPOJFKKJIE

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.742 aoe E channel_demonfire Fluffy_Pillow 49371.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.058 cds L summon_infernal Fluffy_Pillow 49779.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.064 aoe H havoc enemy2 49282.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.072 havoc P chaos_bolt Fluffy_Pillow 48786.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:08.081 havoc M conflagrate Fluffy_Pillow 49790.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:09.087 havoc P chaos_bolt Fluffy_Pillow 49793.5/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.492 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:11.499 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:12.504 havoc P chaos_bolt Fluffy_Pillow 49251.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:13.909 havoc M conflagrate Fluffy_Pillow 49954.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:14.916 havoc P chaos_bolt Fluffy_Pillow 49957.5/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:16.324 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:17.330 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:18.336 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:20.712 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:21.719 aoe F immolate enemy2 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:22.725 aoe F immolate enemy3 49005.5/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:23.733 aoe D rain_of_fire Fluffy_Pillow 48759.5/50000: 98% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:24.740 aoe K incinerate Fluffy_Pillow 49263.0/50000: 99% mana
0.6/5: 12% soul_shard
bloodlust, backdraft
0:25.678 aoe J conflagrate Fluffy_Pillow 48732.0/50000: 97% mana
1.0/5: 20% soul_shard
bloodlust
0:26.685 aoe K incinerate Fluffy_Pillow 48735.5/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:27.624 aoe K incinerate Fluffy_Pillow 48205.0/50000: 96% mana
2.5/5: 50% soul_shard
bloodlust
0:28.963 aoe D rain_of_fire Fluffy_Pillow 47874.5/50000: 96% mana
3.2/5: 64% soul_shard
bloodlust
0:29.970 aoe J conflagrate Fluffy_Pillow 48378.0/50000: 97% mana
0.6/5: 12% soul_shard
bloodlust
0:30.977 aoe K incinerate Fluffy_Pillow 48381.5/50000: 97% mana
1.4/5: 28% soul_shard
bloodlust, backdraft
0:31.915 default A cataclysm Fluffy_Pillow 47850.5/50000: 96% mana
2.0/5: 40% soul_shard
bloodlust
0:33.256 aoe K incinerate Fluffy_Pillow 48021.0/50000: 96% mana
2.4/5: 48% soul_shard
bloodlust
0:34.596 aoe I rain_of_fire Fluffy_Pillow 47691.0/50000: 95% mana
3.0/5: 60% soul_shard
bloodlust
0:35.601 aoe E channel_demonfire Fluffy_Pillow 48193.5/50000: 96% mana
0.2/5: 4% soul_shard
bloodlust
0:37.871 aoe H havoc enemy2 48578.5/50000: 97% mana
0.9/5: 18% soul_shard
bloodlust
0:38.878 havoc M conflagrate Fluffy_Pillow 48082.0/50000: 96% mana
1.0/5: 20% soul_shard
bloodlust
0:39.884 havoc P chaos_bolt Fluffy_Pillow 48085.0/50000: 96% mana
2.2/5: 44% soul_shard
bloodlust, backdraft
0:41.291 havoc Q incinerate Fluffy_Pillow 48788.5/50000: 98% mana
0.3/5: 6% soul_shard
0:43.031 havoc M conflagrate Fluffy_Pillow 48658.5/50000: 97% mana
1.1/5: 22% soul_shard
0:44.338 havoc O immolate Fluffy_Pillow 48812.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
0:45.644 havoc N soul_fire Fluffy_Pillow 48715.0/50000: 97% mana
2.4/5: 48% soul_shard
backdraft
0:49.123 aoe I rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
4.7/5: 94% soul_shard
backdraft
0:50.429 aoe K incinerate Fluffy_Pillow 49656.0/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
0:51.649 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
0:52.956 aoe F immolate enemy3 49156.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
0:54.261 aoe I rain_of_fire Fluffy_Pillow 49058.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
0:55.565 aoe E channel_demonfire Fluffy_Pillow 49710.5/50000: 99% mana
0.2/5: 4% soul_shard
backdraft
0:58.583 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
0:59.804 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
0.8/5: 16% soul_shard
1:01.111 aoe K incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
1:02.331 aoe K incinerate Fluffy_Pillow 48766.5/50000: 98% mana
1.8/5: 36% soul_shard
1:04.071 default A cataclysm Fluffy_Pillow 48636.5/50000: 97% mana
2.4/5: 48% soul_shard
1:05.811 aoe K incinerate Fluffy_Pillow 49006.5/50000: 98% mana
2.7/5: 54% soul_shard
1:07.551 aoe I rain_of_fire Fluffy_Pillow 48876.5/50000: 98% mana
3.1/5: 62% soul_shard
1:08.859 aoe H havoc enemy2 49530.5/50000: 99% mana
0.4/5: 8% soul_shard
1:10.165 havoc Q incinerate Fluffy_Pillow 49183.5/50000: 98% mana
0.4/5: 8% soul_shard
1:11.904 havoc M conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.2/5: 24% soul_shard
1:13.210 havoc P chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
1:15.035 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:16.774 havoc M conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
1:18.081 havoc O immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
1:19.387 havoc Q incinerate Fluffy_Pillow 49058.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:20.606 aoe E channel_demonfire Fluffy_Pillow 48667.5/50000: 97% mana
3.0/5: 60% soul_shard
1:23.397 aoe I rain_of_fire Fluffy_Pillow 49313.0/50000: 99% mana
3.3/5: 66% soul_shard
1:24.702 aoe F immolate enemy3 49965.5/50000: 100% mana
0.6/5: 12% soul_shard
1:26.011 aoe J conflagrate Fluffy_Pillow 49253.5/50000: 99% mana
0.6/5: 12% soul_shard
1:27.318 aoe K incinerate Fluffy_Pillow 49407.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
1:28.538 aoe K incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
1:30.278 aoe K incinerate Fluffy_Pillow 48872.5/50000: 98% mana
2.2/5: 44% soul_shard
1:32.018 aoe K incinerate Fluffy_Pillow 48742.5/50000: 97% mana
2.6/5: 52% soul_shard
1:33.758 aoe J conflagrate Fluffy_Pillow 48612.5/50000: 97% mana
2.9/5: 58% soul_shard
1:35.066 default 9 soul_fire Fluffy_Pillow 48766.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
1:38.542 default A cataclysm Fluffy_Pillow 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
1:40.281 aoe H havoc enemy2 49371.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
1:41.587 havoc P chaos_bolt Fluffy_Pillow 49024.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
1:43.415 havoc M conflagrate Fluffy_Pillow 49938.0/50000: 100% mana
3.0/5: 60% soul_shard
1:44.721 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
1:46.550 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
1:49.161 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:50.468 havoc Q incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
1:52.208 havoc M conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
1:53.514 aoe E channel_demonfire Fluffy_Pillow 49155.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:56.322 aoe K incinerate Fluffy_Pillow 49809.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
1:57.541 aoe I rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.5/5: 70% soul_shard
1:58.848 aoe F immolate enemy3 49655.5/50000: 99% mana
0.7/5: 14% soul_shard
2:00.155 aoe F immolate enemy2 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
2:01.461 aoe J conflagrate Fluffy_Pillow 49155.5/50000: 98% mana
1.0/5: 20% soul_shard
2:02.767 aoe F immolate Fluffy_Pillow 49308.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft
2:04.075 aoe K incinerate Fluffy_Pillow 49212.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
2:05.296 aoe K incinerate Fluffy_Pillow 48823.0/50000: 98% mana
2.3/5: 46% soul_shard
2:07.036 aoe K incinerate Fluffy_Pillow 48693.0/50000: 97% mana
2.6/5: 52% soul_shard
2:08.776 aoe I rain_of_fire Fluffy_Pillow 48563.0/50000: 97% mana
3.2/5: 64% soul_shard
2:10.082 default A cataclysm Fluffy_Pillow 49216.0/50000: 98% mana
0.2/5: 4% soul_shard
2:12.019 aoe H havoc enemy2 49502.5/50000: 99% mana
0.5/5: 10% soul_shard
2:13.325 havoc Q incinerate Fluffy_Pillow 49155.5/50000: 98% mana
0.7/5: 14% soul_shard
2:15.066 havoc M conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
2:16.371 havoc P chaos_bolt Fluffy_Pillow 49155.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:18.199 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
2:19.939 havoc M conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
2:21.245 havoc P chaos_bolt Fluffy_Pillow 49155.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:23.073 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
2:24.379 default 9 soul_fire Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
2:27.858 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
2.2/5: 44% soul_shard
2:30.678 aoe F immolate enemy2 49663.0/50000: 99% mana
2.4/5: 48% soul_shard
2:31.984 aoe F immolate enemy3 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
2:33.292 aoe J conflagrate Fluffy_Pillow 49156.0/50000: 98% mana
2.6/5: 52% soul_shard
2:34.599 aoe I rain_of_fire Fluffy_Pillow 49309.5/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
2:35.905 aoe K incinerate Fluffy_Pillow 49962.5/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
2:37.127 aoe J conflagrate Fluffy_Pillow 49003.5/50000: 98% mana
0.9/5: 18% soul_shard
2:38.431 aoe K incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
2:39.650 aoe K incinerate Fluffy_Pillow 48765.0/50000: 98% mana
1.9/5: 38% soul_shard
2:41.389 aoe K incinerate Fluffy_Pillow 48634.5/50000: 97% mana
2.2/5: 44% soul_shard
2:43.129 default A cataclysm Fluffy_Pillow 48504.5/50000: 97% mana
2.7/5: 54% soul_shard
2:44.869 aoe H havoc enemy2 48874.5/50000: 98% mana
2.9/5: 58% soul_shard
2:46.175 havoc M conflagrate Fluffy_Pillow 48527.5/50000: 97% mana
3.0/5: 60% soul_shard
2:47.482 havoc P chaos_bolt Fluffy_Pillow 48681.0/50000: 97% mana
4.2/5: 84% soul_shard
backdraft
2:49.309 havoc P chaos_bolt Fluffy_Pillow 49594.5/50000: 99% mana
2.3/5: 46% soul_shard
2:51.917 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
2:53.656 havoc M conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
2:54.962 havoc O immolate Fluffy_Pillow 49154.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:56.268 aoe E channel_demonfire Fluffy_Pillow 49057.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:59.051 aoe K incinerate Fluffy_Pillow 49699.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
3:00.270 aoe I rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.3/5: 66% soul_shard
3:01.579 aoe J conflagrate Fluffy_Pillow 49656.5/50000: 99% mana
0.4/5: 8% soul_shard
3:02.887 aoe K incinerate Fluffy_Pillow 49810.5/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
3:04.107 aoe F immolate enemy3 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
3:05.414 cds L summon_infernal Fluffy_Pillow 48906.0/50000: 98% mana
1.6/5: 32% soul_shard
3:06.721 aoe K incinerate Fluffy_Pillow 48559.5/50000: 97% mana
1.9/5: 38% soul_shard
3:08.463 aoe J conflagrate Fluffy_Pillow 48430.5/50000: 97% mana
2.8/5: 56% soul_shard
3:09.789 aoe D rain_of_fire Fluffy_Pillow 48593.5/50000: 97% mana
3.5/5: 70% soul_shard
backdraft
3:11.096 aoe K incinerate Fluffy_Pillow 49247.0/50000: 98% mana
1.1/5: 22% soul_shard
backdraft
3:12.314 aoe K incinerate Fluffy_Pillow 48856.0/50000: 98% mana
1.5/5: 30% soul_shard
3:14.056 default 9 soul_fire Fluffy_Pillow 48727.0/50000: 97% mana
2.6/5: 52% soul_shard
3:17.533 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
4.7/5: 94% soul_shard
3:19.275 aoe E channel_demonfire Fluffy_Pillow 49373.0/50000: 99% mana
5.0/5: 100% soul_shard
3:22.086 aoe H havoc enemy2 50000.0/50000: 100% mana
5.0/5: 100% soul_shard
3:23.391 havoc P chaos_bolt Fluffy_Pillow 49652.5/50000: 99% mana
5.0/5: 100% soul_shard
3:26.001 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:27.307 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:29.134 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:30.441 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:31.748 havoc P chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
3:33.576 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:34.881 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
3:36.187 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
backdraft
3:37.405 aoe K incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.7/5: 34% soul_shard
3:39.147 aoe F immolate enemy3 48872.5/50000: 98% mana
2.2/5: 44% soul_shard
3:40.452 aoe F immolate enemy2 48775.0/50000: 98% mana
2.4/5: 48% soul_shard
3:41.759 aoe E channel_demonfire Fluffy_Pillow 48678.5/50000: 97% mana
2.5/5: 50% soul_shard
3:44.592 aoe F immolate Fluffy_Pillow 49345.0/50000: 99% mana
2.8/5: 56% soul_shard
3:45.897 aoe I rain_of_fire Fluffy_Pillow 49247.5/50000: 98% mana
3.1/5: 62% soul_shard
3:47.204 aoe J conflagrate Fluffy_Pillow 49901.0/50000: 100% mana
0.2/5: 4% soul_shard
3:48.511 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
3:49.730 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
3:51.471 aoe K incinerate Fluffy_Pillow 49372.5/50000: 99% mana
1.5/5: 30% soul_shard
3:53.211 aoe H havoc enemy2 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
3:54.519 havoc M conflagrate Fluffy_Pillow 48656.0/50000: 97% mana
2.0/5: 40% soul_shard
3:55.827 havoc P chaos_bolt Fluffy_Pillow 48810.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
3:57.655 havoc Q incinerate Fluffy_Pillow 49724.0/50000: 99% mana
1.5/5: 30% soul_shard
3:59.396 havoc P chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
4:02.007 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
4:03.313 havoc Q incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.8/5: 16% soul_shard
4:05.052 havoc M conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.4/5: 28% soul_shard
4:06.358 default 9 soul_fire Fluffy_Pillow 49154.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
4:09.835 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
4:12.714 aoe F immolate enemy3 49691.5/50000: 99% mana
4.5/5: 90% soul_shard
backdraft
4:14.021 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
4:15.328 aoe J conflagrate Fluffy_Pillow 49906.0/50000: 100% mana
1.8/5: 36% soul_shard
4:16.635 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft
4:17.855 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.8/5: 56% soul_shard
4:19.163 aoe I rain_of_fire Fluffy_Pillow 49156.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
4:20.468 aoe K incinerate Fluffy_Pillow 49809.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
4:21.688 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
4:23.430 aoe H havoc enemy2 49373.5/50000: 99% mana
1.4/5: 28% soul_shard
4:24.735 havoc Q incinerate Fluffy_Pillow 49026.0/50000: 98% mana
1.4/5: 28% soul_shard
4:26.475 havoc M conflagrate Fluffy_Pillow 48896.0/50000: 98% mana
2.1/5: 42% soul_shard
4:27.781 havoc P chaos_bolt Fluffy_Pillow 49049.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
4:29.609 havoc Q incinerate Fluffy_Pillow 49963.0/50000: 100% mana
1.5/5: 30% soul_shard
4:31.350 havoc P chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
4:33.961 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
4:35.268 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
0.5/5: 10% soul_shard
4:37.966 aoe J conflagrate Fluffy_Pillow 49851.5/50000: 100% mana
1.1/5: 22% soul_shard
4:39.272 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft
4:40.491 aoe K incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
4:42.233 aoe F immolate enemy3 48873.0/50000: 98% mana
2.6/5: 52% soul_shard
4:43.539 aoe J conflagrate Fluffy_Pillow 48776.0/50000: 98% mana
2.8/5: 56% soul_shard
4:44.929 aoe F immolate enemy2 48971.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
4:46.235 aoe I rain_of_fire Fluffy_Pillow 48874.0/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
4:47.541 aoe K incinerate Fluffy_Pillow 49527.0/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
4:48.761 aoe K incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
4:50.502 aoe K incinerate Fluffy_Pillow 48873.0/50000: 98% mana
1.6/5: 32% soul_shard
4:52.243 aoe J conflagrate Fluffy_Pillow 48743.5/50000: 97% mana
2.1/5: 42% soul_shard
4:53.577 default A cataclysm Fluffy_Pillow 48910.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:55.317 default 9 soul_fire Fluffy_Pillow 49280.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
4:58.795 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
4.4/5: 88% soul_shard
backdraft
5:01.516 aoe H havoc enemy2 49613.0/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
5:02.823 havoc P chaos_bolt Fluffy_Pillow 49266.5/50000: 99% mana
4.9/5: 98% soul_shard
5:05.432 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
5:06.738 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
backdraft
5:08.565 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
5:11.173 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
5:12.480 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
0.7/5: 14% soul_shard
5:13.786 aoe F immolate enemy3 49405.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
5:15.093 aoe K incinerate Fluffy_Pillow 49252.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
5:16.314 aoe K incinerate Fluffy_Pillow 48863.0/50000: 98% mana
2.5/5: 50% soul_shard
5:18.056 aoe J conflagrate Fluffy_Pillow 48734.0/50000: 97% mana
2.9/5: 58% soul_shard
5:19.525 aoe I rain_of_fire Fluffy_Pillow 48968.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
5:20.832 aoe E channel_demonfire Fluffy_Pillow 49622.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="destruction"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Simulation & Raid Information

Iterations: 643
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 241 - 360 ( 301.0 )

Performance:

Total Events Processed: 27247685
Max Event Queue: 545
Sim Seconds: 193534
CPU Seconds: 52.9531
Physical Seconds: 3.6987
Speed Up: 3655

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Kyrian_Forgelite Kyrian_Forgelite cataclysm 152108 233061 774 5.82 6700 13406 9.7 29.2 19.2% 0.0% 0.0% 0.0% 32.33sec 233061 300.99sec
Kyrian_Forgelite Kyrian_Forgelite channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.65sec 0 300.99sec
Kyrian_Forgelite Kyrian_Forgelite channel_demonfire_tick 196448 301095 1000 107.37 469 937 0.0 538.6 19.3% 0.0% 0.0% 0.0% 0.00sec 301095 300.99sec
Kyrian_Forgelite Kyrian_Forgelite chaos_bolt 116858 337963 1123 7.46 0 9034 18.8 37.4 100.0% 0.0% 0.0% 0.0% 15.55sec 337963 300.99sec
Kyrian_Forgelite Kyrian_Forgelite internal_combustion 266134 110631 368 7.25 2565 5063 36.4 36.4 19.1% 0.0% 0.0% 0.0% 15.65sec 110631 300.99sec
Kyrian_Forgelite Kyrian_Forgelite conflagrate 17962 238111 791 10.98 3622 7264 37.0 55.1 19.3% 0.0% 0.0% 0.0% 7.96sec 238111 300.99sec
Kyrian_Forgelite Kyrian_Forgelite havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.23sec 0 300.99sec
Kyrian_Forgelite Kyrian_Forgelite immolate 348 57563 191 6.35 1515 3029 25.5 31.9 19.2% 0.0% 0.0% 0.0% 11.39sec 478358 300.99sec
Kyrian_Forgelite Kyrian_Forgelite immolate ticks -348 420795 1403 69.59 1014 2029 25.5 348.0 19.2% 0.0% 0.0% 0.0% 11.39sec 478358 300.99sec
Kyrian_Forgelite Kyrian_Forgelite incinerate 29722 166957 555 10.05 2780 5560 39.6 50.4 19.1% 0.0% 0.0% 0.0% 7.10sec 166957 300.99sec
Kyrian_Forgelite Kyrian_Forgelite rain_of_fire ticks -5740 290191 967 0.00 553 1106 18.5 0.0 19.3% 0.0% 0.0% 0.0% 15.74sec 290191 300.99sec
Kyrian_Forgelite Kyrian_Forgelite scouring_tithe 312321 33168 110 3.75 1483 2966 13.5 18.8 18.8% 0.0% 0.0% 0.0% 22.66sec 98993 300.99sec
Kyrian_Forgelite Kyrian_Forgelite scouring_tithe ticks -312321 65824 219 26.72 413 826 13.5 133.6 19.3% 0.0% 0.0% 0.0% 22.66sec 98993 300.99sec
Kyrian_Forgelite Kyrian_Forgelite soul_fire 6353 144435 480 1.47 16242 32582 5.6 7.4 20.1% 0.0% 0.0% 0.0% 49.41sec 144435 300.99sec
Kyrian_Forgelite Kyrian_Forgelite summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
Kyrian_Forgelite Kyrian_Forgelite summon_infernal 1122 23955 80 1.20 3348 6696 2.0 6.0 19.2% 0.0% 0.0% 0.0% 180.78sec 23955 300.99sec
Kyrian_Forgelite Kyrian_Forgelite_infernal immolation 20153 213113 3552 117.00 1529 3059 39.0 117.0 19.1% 0.0% 0.0% 0.0% 5.50sec 213113 60.00sec
Kyrian_Forgelite Kyrian_Forgelite_infernal melee 0 15996 267 41.00 326 651 41.0 41.0 19.8% 0.0% 0.0% 0.0% 5.26sec 22848 60.00sec
Kyrian_Forgelite Kyrian_Forgelite_imp firebolt 3110 154680 514 18.52 1395 2790 93.6 92.9 19.4% 0.0% 0.0% 0.0% 3.21sec 154680 300.99sec
Kyrian_Forgelite Kyrian_Forgelite_bron anima_cannon 332525 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 8.00sec 0 30.00sec
Kyrian_Forgelite Kyrian_Forgelite_bron goliath_support 332526 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 4.00sec 0 30.00sec
Kyrian_Forgelite Kyrian_Forgelite_bron melee 0 1841 61 18.00 172 343 9.0 9.0 19.1% 0.0% 0.0% 0.0% 2.88sec 2630 30.00sec
Kyrian_Forgelite Kyrian_Forgelite_bron smash 341163 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 8.17sec 0 30.00sec
Kyrian_Kleia Kyrian_Kleia cataclysm 152108 233483 776 5.82 6700 13393 9.7 29.2 19.5% 0.0% 0.0% 0.0% 32.38sec 233483 300.99sec
Kyrian_Kleia Kyrian_Kleia channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 26.10sec 0 300.99sec
Kyrian_Kleia Kyrian_Kleia channel_demonfire_tick 196448 299902 996 106.97 469 939 0.0 536.6 19.1% 0.0% 0.0% 0.0% 0.00sec 299902 300.99sec
Kyrian_Kleia Kyrian_Kleia chaos_bolt 116858 338578 1125 7.47 0 9040 18.8 37.5 100.0% 0.0% 0.0% 0.0% 15.41sec 338578 300.99sec
Kyrian_Kleia Kyrian_Kleia internal_combustion 266134 110986 369 7.27 2557 5113 36.4 36.4 19.1% 0.0% 0.0% 0.0% 15.52sec 110986 300.99sec
Kyrian_Kleia Kyrian_Kleia conflagrate 17962 237232 788 10.97 3621 7232 37.0 55.0 19.1% 0.0% 0.0% 0.0% 7.95sec 237232 300.99sec
Kyrian_Kleia Kyrian_Kleia havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.23sec 0 300.99sec
Kyrian_Kleia Kyrian_Kleia immolate 348 57887 192 6.36 1517 3026 25.5 31.9 19.8% 0.0% 0.0% 0.0% 11.35sec 478841 300.99sec
Kyrian_Kleia Kyrian_Kleia immolate ticks -348 420953 1403 69.61 1015 2029 25.5 348.1 19.2% 0.0% 0.0% 0.0% 11.35sec 478841 300.99sec
Kyrian_Kleia Kyrian_Kleia incinerate 29722 166911 555 10.02 2780 5564 39.5 50.2 19.4% 0.0% 0.0% 0.0% 7.11sec 166911 300.99sec
Kyrian_Kleia Kyrian_Kleia rain_of_fire ticks -5740 290384 968 0.00 553 1106 18.6 0.0 19.2% 0.0% 0.0% 0.0% 15.55sec 290384 300.99sec
Kyrian_Kleia Kyrian_Kleia scouring_tithe 312321 33291 111 3.75 1485 2963 13.5 18.8 19.3% 0.0% 0.0% 0.0% 22.65sec 99046 300.99sec
Kyrian_Kleia Kyrian_Kleia scouring_tithe ticks -312321 65756 219 26.67 413 826 13.5 133.4 19.3% 0.0% 0.0% 0.0% 22.65sec 99046 300.99sec
Kyrian_Kleia Kyrian_Kleia soul_fire 6353 144274 479 1.48 16235 32790 5.6 7.4 19.4% 0.0% 0.0% 0.0% 49.40sec 144274 300.99sec
Kyrian_Kleia Kyrian_Kleia summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
Kyrian_Kleia Kyrian_Kleia summon_infernal 1122 23928 79 1.20 3348 6696 2.0 6.0 19.1% 0.0% 0.0% 0.0% 180.46sec 23928 300.99sec
Kyrian_Kleia Kyrian_Kleia_infernal immolation 20153 212806 3547 117.00 1529 3059 39.0 117.0 18.9% 0.0% 0.0% 0.0% 5.49sec 212806 60.00sec
Kyrian_Kleia Kyrian_Kleia_infernal melee 0 15939 266 41.00 326 651 41.0 41.0 19.4% 0.0% 0.0% 0.0% 5.25sec 22767 60.00sec
Kyrian_Kleia Kyrian_Kleia_imp firebolt 3110 154704 514 18.52 1395 2790 93.6 92.9 19.4% 0.0% 0.0% 0.0% 3.21sec 154704 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage cataclysm 152108 242908 807 5.82 6698 13404 9.7 29.2 24.2% 0.0% 0.0% 0.0% 32.34sec 242908 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage channel_demonfire 196447 0 0 0.00 0 0 12.2 0.0 0.0% 0.0% 0.0% 0.0% 25.39sec 0 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage channel_demonfire_tick 196448 317589 1055 108.95 467 935 0.0 546.6 24.3% 0.0% 0.0% 0.0% 0.00sec 317589 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage chaos_bolt 116858 353779 1175 7.49 0 9415 18.9 37.6 100.0% 0.0% 0.0% 0.0% 15.48sec 353779 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage internal_combustion 266134 115934 385 7.26 2566 5125 36.4 36.4 24.2% 0.0% 0.0% 0.0% 15.50sec 115934 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage conflagrate 17962 247671 823 10.98 3618 7275 37.0 55.1 24.0% 0.0% 0.0% 0.0% 7.96sec 247671 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.18sec 0 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage immolate 348 60156 200 6.36 1517 3030 25.6 31.9 24.3% 0.0% 0.0% 0.0% 11.19sec 498795 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage immolate ticks -348 438639 1462 69.58 1015 2031 25.6 347.9 24.2% 0.0% 0.0% 0.0% 11.19sec 498795 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage incinerate 29722 172464 573 9.97 2773 5562 39.0 50.0 24.2% 0.0% 0.0% 0.0% 7.30sec 172464 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage rain_of_fire ticks -5740 304795 1016 0.00 553 1106 18.7 0.0 24.3% 0.0% 0.0% 0.0% 15.36sec 304795 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage scouring_tithe 312321 34590 115 3.71 1484 2976 13.4 18.6 25.0% 0.0% 0.0% 0.0% 22.74sec 102598 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage scouring_tithe ticks -312321 68008 227 26.47 413 827 13.4 132.3 24.4% 0.0% 0.0% 0.0% 22.74sec 102598 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage soul_fire 6353 147835 491 1.47 16402 33018 5.6 7.4 22.2% 0.0% 0.0% 0.0% 49.47sec 147835 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage summon_infernal 1122 25178 84 1.20 3348 6696 2.0 6.0 25.3% 0.0% 0.0% 0.0% 180.70sec 25178 300.99sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage_infernal immolation 20153 202742 3379 117.00 1395 2790 39.0 117.0 24.2% 0.0% 0.0% 0.0% 5.50sec 202742 60.00sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage_infernal melee 0 16581 276 41.00 326 651 41.0 41.0 24.2% 0.0% 0.0% 0.0% 5.26sec 23684 60.00sec
Kyrian_Kleia_Courage Kyrian_Kleia_Courage_imp firebolt 3110 161395 536 18.52 1395 2790 93.6 92.9 24.5% 0.0% 0.0% 0.0% 3.21sec 161395 300.99sec
Kyrian_Pelagos Kyrian_Pelagos cataclysm 152108 241574 803 5.82 6934 13880 9.7 29.2 19.3% 0.0% 0.0% 0.0% 32.32sec 241574 300.99sec
Kyrian_Pelagos Kyrian_Pelagos channel_demonfire 196447 0 0 0.00 0 0 11.9 0.0 0.0% 0.0% 0.0% 0.0% 26.16sec 0 300.99sec
Kyrian_Pelagos Kyrian_Pelagos channel_demonfire_tick 196448 319830 1063 106.75 501 1001 0.0 535.5 19.3% 0.0% 0.0% 0.0% 0.00sec 319830 300.99sec
Kyrian_Pelagos Kyrian_Pelagos chaos_bolt 116858 364911 1212 7.50 0 9703 18.9 37.6 100.0% 0.0% 0.0% 0.0% 15.36sec 364911 300.99sec
Kyrian_Pelagos Kyrian_Pelagos internal_combustion 266134 123065 409 7.30 2818 5647 36.6 36.6 19.2% 0.0% 0.0% 0.0% 15.48sec 123065 300.99sec
Kyrian_Pelagos Kyrian_Pelagos conflagrate 17962 254049 844 10.98 3861 7752 37.0 55.1 19.3% 0.0% 0.0% 0.0% 7.96sec 254049 300.99sec
Kyrian_Pelagos Kyrian_Pelagos havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.16sec 0 300.99sec
Kyrian_Pelagos Kyrian_Pelagos immolate 348 62022 206 6.34 1633 3267 25.5 31.8 19.5% 0.0% 0.0% 0.0% 11.42sec 509844 300.99sec
Kyrian_Pelagos Kyrian_Pelagos immolate ticks -348 447821 1493 69.59 1078 2158 25.5 348.0 19.3% 0.0% 0.0% 0.0% 11.42sec 509844 300.99sec
Kyrian_Pelagos Kyrian_Pelagos incinerate 29722 177033 588 10.03 2959 5920 39.6 50.3 18.9% 0.0% 0.0% 0.0% 7.11sec 177033 300.99sec
Kyrian_Pelagos Kyrian_Pelagos rain_of_fire ticks -5740 308194 1027 0.00 588 1175 18.5 0.0 19.4% 0.0% 0.0% 0.0% 15.75sec 308194 300.99sec
Kyrian_Pelagos Kyrian_Pelagos scouring_tithe 312321 34191 114 3.75 1523 3031 13.4 18.8 19.3% 0.0% 0.0% 0.0% 22.47sec 101876 300.99sec
Kyrian_Pelagos Kyrian_Pelagos scouring_tithe ticks -312321 67686 226 26.79 424 848 13.4 134.0 19.1% 0.0% 0.0% 0.0% 22.47sec 101876 300.99sec
Kyrian_Pelagos Kyrian_Pelagos soul_fire 6353 149326 496 1.49 16849 33797 5.6 7.5 18.8% 0.0% 0.0% 0.0% 49.39sec 149326 300.99sec
Kyrian_Pelagos Kyrian_Pelagos summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
Kyrian_Pelagos Kyrian_Pelagos summon_infernal 1122 24329 81 1.20 3423 6845 2.0 6.0 18.5% 0.0% 0.0% 0.0% 180.72sec 24329 300.99sec
Kyrian_Pelagos Kyrian_Pelagos_infernal immolation 20153 219216 3653 117.00 1571 3131 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.50sec 219216 60.00sec
Kyrian_Pelagos Kyrian_Pelagos_infernal melee 0 16289 271 41.00 334 668 41.0 41.0 18.9% 0.0% 0.0% 0.0% 5.26sec 23267 60.00sec
Kyrian_Pelagos Kyrian_Pelagos_imp firebolt 3110 158421 526 18.52 1432 2863 93.6 92.9 19.1% 0.0% 0.0% 0.0% 3.21sec 158421 300.99sec
Necrolord_Emeni Necrolord_Emeni cataclysm 152108 237957 791 5.80 6813 13662 9.7 29.1 19.9% 0.0% 0.0% 0.0% 32.43sec 237957 300.99sec
Necrolord_Emeni Necrolord_Emeni channel_demonfire 196447 0 0 0.00 0 0 12.1 0.0 0.0% 0.0% 0.0% 0.0% 25.76sec 0 300.99sec
Necrolord_Emeni Necrolord_Emeni channel_demonfire_tick 196448 313836 1043 108.34 484 967 0.0 543.5 19.3% 0.0% 0.0% 0.0% 0.00sec 313836 300.99sec
Necrolord_Emeni Necrolord_Emeni chaos_bolt 116858 358564 1191 7.56 0 9457 19.1 37.9 100.0% 0.0% 0.0% 0.0% 15.39sec 358564 300.99sec
Necrolord_Emeni Necrolord_Emeni internal_combustion 266134 117996 392 7.40 2662 5313 37.1 37.1 19.4% 0.0% 0.0% 0.0% 15.40sec 117996 300.99sec
Necrolord_Emeni Necrolord_Emeni conflagrate 17962 247291 822 11.05 3741 7503 36.9 55.4 19.1% 0.0% 0.0% 0.0% 7.95sec 247291 300.99sec
Necrolord_Emeni Necrolord_Emeni decimating_bolt 325289 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 49.21sec 0 300.99sec
Necrolord_Emeni Necrolord_Emeni decimating_bolt_tick_t 327059 57170 190 7.85 1210 2431 0.0 39.4 19.7% 0.0% 0.0% 0.0% 0.00sec 57170 300.99sec
Necrolord_Emeni Necrolord_Emeni havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.20sec 0 300.99sec
Necrolord_Emeni Necrolord_Emeni immolate 348 59702 198 6.45 1544 3088 25.8 32.4 19.4% 0.0% 0.0% 0.0% 11.09sec 494195 300.99sec
Necrolord_Emeni Necrolord_Emeni immolate ticks -348 434493 1448 70.03 1042 2083 25.8 350.2 19.1% 0.0% 0.0% 0.0% 11.09sec 494195 300.99sec
Necrolord_Emeni Necrolord_Emeni incinerate 29722 282596 939 10.89 4346 8627 43.7 54.6 19.3% 0.0% 0.0% 0.0% 6.40sec 282596 300.99sec
Necrolord_Emeni Necrolord_Emeni rain_of_fire ticks -5740 298446 995 0.00 565 1129 18.7 0.0 19.2% 0.0% 0.0% 0.0% 15.47sec 298446 300.99sec
Necrolord_Emeni Necrolord_Emeni soul_fire 6353 149699 497 1.58 15886 31656 5.6 7.9 19.2% 0.0% 0.0% 0.0% 49.49sec 149699 300.99sec
Necrolord_Emeni Necrolord_Emeni summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
Necrolord_Emeni Necrolord_Emeni summon_infernal 1122 24158 80 1.20 3348 6696 2.0 6.0 20.3% 0.0% 0.0% 0.0% 180.50sec 24158 300.99sec
Necrolord_Emeni Necrolord_Emeni_infernal immolation 20153 221583 3693 117.00 1589 3183 39.0 117.0 19.1% 0.0% 0.0% 0.0% 5.49sec 221583 60.00sec
Necrolord_Emeni Necrolord_Emeni_infernal melee 0 16515 275 41.00 338 676 41.0 41.0 19.2% 0.0% 0.0% 0.0% 5.25sec 23591 60.00sec
Necrolord_Emeni Necrolord_Emeni_imp firebolt 3110 157736 524 18.52 1427 2852 93.6 92.9 19.0% 0.0% 0.0% 0.0% 3.21sec 157736 300.99sec
NightFae_Dream NightFae_Dream cataclysm 152108 236172 785 5.82 6805 13598 9.7 29.2 18.9% 0.0% 0.0% 0.0% 32.31sec 236172 300.99sec
NightFae_Dream NightFae_Dream channel_demonfire 196447 0 0 0.00 0 0 12.5 0.0 0.0% 0.0% 0.0% 0.0% 24.73sec 0 300.99sec
NightFae_Dream NightFae_Dream channel_demonfire_tick 196448 318214 1057 111.52 477 954 0.0 559.4 19.2% 0.0% 0.0% 0.0% 0.00sec 318214 300.99sec
NightFae_Dream NightFae_Dream chaos_bolt 116858 391073 1299 8.51 0 9158 21.5 42.7 100.0% 0.0% 0.0% 0.0% 13.69sec 391073 300.99sec
NightFae_Dream NightFae_Dream internal_combustion 266134 146091 485 8.43 2895 5802 42.3 42.3 19.3% 0.0% 0.0% 0.0% 13.65sec 146091 300.99sec
NightFae_Dream NightFae_Dream conflagrate 17962 251550 836 11.44 3671 7364 38.1 57.4 19.3% 0.0% 0.0% 0.0% 7.73sec 251550 300.99sec
NightFae_Dream NightFae_Dream havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.06sec 0 300.99sec
NightFae_Dream NightFae_Dream immolate 348 64461 214 6.92 1553 3094 26.8 34.7 19.7% 0.0% 0.0% 0.0% 10.78sec 503033 300.99sec
NightFae_Dream NightFae_Dream immolate ticks -348 438572 1462 71.65 1027 2054 26.8 358.2 19.2% 0.0% 0.0% 0.0% 10.78sec 503033 300.99sec
NightFae_Dream NightFae_Dream incinerate 29722 210300 699 12.52 2811 5618 48.9 62.8 19.1% 0.0% 0.0% 0.0% 5.84sec 210300 300.99sec
NightFae_Dream NightFae_Dream rain_of_fire ticks -5740 296485 988 0.00 560 1121 18.7 0.0 19.2% 0.0% 0.0% 0.0% 15.27sec 296485 300.99sec
NightFae_Dream NightFae_Dream soul_fire 6353 156397 520 1.54 16893 34020 5.6 7.7 19.4% 0.0% 0.0% 0.0% 49.39sec 156397 300.99sec
NightFae_Dream NightFae_Dream soul_rot ticks -325640 112527 375 22.65 832 1665 5.3 113.2 19.4% 0.0% 0.0% 0.0% 62.08sec 112527 300.99sec
NightFae_Dream NightFae_Dream summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
NightFae_Dream NightFae_Dream summon_infernal 1122 24193 80 1.20 3405 6806 2.0 6.0 18.4% 0.0% 0.0% 0.0% 180.87sec 24193 300.99sec
NightFae_Dream NightFae_Dream_infernal immolation 20153 207338 3456 123.00 1414 2827 41.0 123.0 19.2% 0.0% 0.0% 0.0% 5.23sec 207338 60.00sec
NightFae_Dream NightFae_Dream_infernal melee 0 16919 282 43.00 330 660 43.0 43.0 19.3% 0.0% 0.0% 0.0% 5.01sec 24167 60.00sec
NightFae_Dream NightFae_Dream_imp firebolt 3110 161379 536 19.07 1413 2826 96.4 95.7 19.4% 0.0% 0.0% 0.0% 3.12sec 161379 300.99sec
NightFae_Koraylon NightFae_Koraylon cataclysm 152108 240209 798 5.81 6899 13791 9.7 29.1 19.5% 0.0% 0.0% 0.0% 32.40sec 240209 300.99sec
NightFae_Koraylon NightFae_Koraylon channel_demonfire 196447 0 0 0.00 0 0 12.1 0.0 0.0% 0.0% 0.0% 0.0% 26.00sec 0 300.99sec
NightFae_Koraylon NightFae_Koraylon channel_demonfire_tick 196448 317708 1056 107.92 492 985 0.0 541.4 19.3% 0.0% 0.0% 0.0% 0.00sec 317708 300.99sec
NightFae_Koraylon NightFae_Koraylon chaos_bolt 116858 406044 1349 8.68 0 9321 21.9 43.6 100.0% 0.0% 0.0% 0.0% 13.24sec 406044 300.99sec
NightFae_Koraylon NightFae_Koraylon internal_combustion 266134 144737 481 8.61 2813 5612 43.2 43.2 19.2% 0.0% 0.0% 0.0% 13.26sec 144737 300.99sec
NightFae_Koraylon NightFae_Koraylon conflagrate 17962 250438 832 11.32 3699 7409 37.1 56.8 19.2% 0.0% 0.0% 0.0% 7.94sec 250438 300.99sec
NightFae_Koraylon NightFae_Koraylon havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.03sec 0 300.99sec
NightFae_Koraylon NightFae_Koraylon immolate 348 63941 212 6.82 1568 3135 26.9 34.2 19.2% 0.0% 0.0% 0.0% 10.76sec 495516 300.99sec
NightFae_Koraylon NightFae_Koraylon immolate ticks -348 431575 1439 69.66 1041 2082 26.9 348.3 19.0% 0.0% 0.0% 0.0% 10.76sec 495516 300.99sec
NightFae_Koraylon NightFae_Koraylon incinerate 29722 187599 623 10.98 2859 5702 44.6 55.1 19.3% 0.0% 0.0% 0.0% 6.14sec 187599 300.99sec
NightFae_Koraylon NightFae_Koraylon rain_of_fire ticks -5740 280761 936 0.00 570 1139 17.4 0.0 19.3% 0.0% 0.0% 0.0% 16.55sec 280761 300.99sec
NightFae_Koraylon NightFae_Koraylon soul_fire 6353 159468 530 1.56 16933 33956 5.6 7.8 20.3% 0.0% 0.0% 0.0% 49.33sec 159468 300.99sec
NightFae_Koraylon NightFae_Koraylon soul_rot ticks -325640 106035 353 19.45 914 1827 5.3 97.2 19.3% 0.0% 0.0% 0.0% 62.27sec 106035 300.99sec
NightFae_Koraylon NightFae_Koraylon summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
NightFae_Koraylon NightFae_Koraylon summon_infernal 1122 25205 84 1.20 3515 7034 2.0 6.0 19.5% 0.0% 0.0% 0.0% 180.63sec 25205 300.99sec
NightFae_Koraylon NightFae_Koraylon_infernal immolation 20153 213292 3555 117.00 1529 3057 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.49sec 213292 60.00sec
NightFae_Koraylon NightFae_Koraylon_infernal melee 0 15975 266 41.00 326 651 41.0 41.0 19.7% 0.0% 0.0% 0.0% 5.25sec 22819 60.00sec
NightFae_Koraylon NightFae_Koraylon_imp firebolt 3110 154133 512 18.52 1395 2790 93.6 92.9 18.9% 0.0% 0.0% 0.0% 3.21sec 154133 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS cataclysm 152108 245328 815 5.81 6872 13901 9.7 29.2 21.9% 0.0% 0.0% 0.0% 32.47sec 245328 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.56sec 0 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS channel_demonfire_tick 196448 322537 1072 107.58 494 978 0.0 539.7 21.4% 0.0% 0.0% 0.0% 0.00sec 322537 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS chaos_bolt 116858 404447 1344 8.65 0 9321 21.8 43.4 100.0% 0.0% 0.0% 0.0% 13.06sec 404447 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS internal_combustion 266134 144641 481 8.58 2816 5608 43.1 43.1 19.4% 0.0% 0.0% 0.0% 13.07sec 144641 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS conflagrate 17962 249852 830 11.33 3702 7359 37.0 56.8 19.0% 0.0% 0.0% 0.0% 7.96sec 249852 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.12sec 0 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS immolate 348 63866 212 6.77 1570 3140 26.8 34.0 19.7% 0.0% 0.0% 0.0% 10.64sec 498327 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS immolate ticks -348 434461 1448 69.68 1041 2082 26.8 348.4 19.8% 0.0% 0.0% 0.0% 10.64sec 498327 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS incinerate 29722 189131 628 11.05 2857 5712 44.8 55.4 19.4% 0.0% 0.0% 0.0% 6.22sec 189131 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS rain_of_fire ticks -5740 282058 940 0.00 570 1140 17.5 0.0 19.3% 0.0% 0.0% 0.0% 16.78sec 282058 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS soul_fire 6353 158943 528 1.57 16945 33748 5.6 7.9 19.2% 0.0% 0.0% 0.0% 49.48sec 158943 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS soul_rot ticks -325640 108013 360 19.43 912 1846 5.3 97.1 21.5% 0.0% 0.0% 0.0% 62.40sec 108013 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS summon_infernal 1122 28228 94 1.20 3482 7164 2.0 6.0 33.2% 0.0% 0.0% 0.0% 180.63sec 28228 300.99sec
NightFae_Koraylon_FS NightFae_Koraylon_FS_infernal immolation 20153 195768 3263 117.00 1395 2790 39.0 117.0 19.9% 0.0% 0.0% 0.0% 5.49sec 195768 60.00sec
NightFae_Koraylon_FS NightFae_Koraylon_FS_infernal melee 0 16029 267 41.00 326 651 41.0 41.0 20.1% 0.0% 0.0% 0.0% 5.25sec 22896 60.00sec
NightFae_Koraylon_FS NightFae_Koraylon_FS_imp firebolt 3110 156435 520 18.52 1395 2790 93.6 92.9 20.7% 0.0% 0.0% 0.0% 3.21sec 156435 300.99sec
NightFae_Niya NightFae_Niya cataclysm 152108 240221 798 5.82 6885 13823 9.7 29.2 19.4% 0.0% 0.0% 0.0% 32.26sec 240221 300.99sec
NightFae_Niya NightFae_Niya channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.78sec 0 300.99sec
NightFae_Niya NightFae_Niya channel_demonfire_tick 196448 319359 1061 107.50 496 993 0.0 539.3 19.3% 0.0% 0.0% 0.0% 0.00sec 319359 300.99sec
NightFae_Niya NightFae_Niya chaos_bolt 116858 407464 1354 8.61 0 9439 21.7 43.2 100.0% 0.0% 0.0% 0.0% 13.56sec 407464 300.99sec
NightFae_Niya NightFae_Niya internal_combustion 266134 140250 466 8.53 2742 5506 42.8 42.8 19.4% 0.0% 0.0% 0.0% 13.55sec 140250 300.99sec
NightFae_Niya NightFae_Niya conflagrate 17962 253959 844 11.32 3743 7496 37.1 56.8 19.5% 0.0% 0.0% 0.0% 7.95sec 253959 300.99sec
NightFae_Niya NightFae_Niya havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 31.89sec 0 300.99sec
NightFae_Niya NightFae_Niya immolate 348 64838 215 6.77 1598 3200 26.8 34.0 19.4% 0.0% 0.0% 0.0% 10.92sec 503745 300.99sec
NightFae_Niya NightFae_Niya immolate ticks -348 438906 1463 69.67 1056 2113 26.8 348.4 19.3% 0.0% 0.0% 0.0% 10.92sec 503745 300.99sec
NightFae_Niya NightFae_Niya incinerate 29722 192550 640 11.09 2902 5799 44.9 55.6 19.3% 0.0% 0.0% 0.0% 6.07sec 192550 300.99sec
NightFae_Niya NightFae_Niya rain_of_fire ticks -5740 287212 957 0.00 576 1152 17.6 0.0 19.5% 0.0% 0.0% 0.0% 16.06sec 287212 300.99sec
NightFae_Niya NightFae_Niya soul_fire 6353 157721 524 1.57 16857 33449 5.6 7.9 19.0% 0.0% 0.0% 0.0% 49.43sec 157721 300.99sec
NightFae_Niya NightFae_Niya soul_rot ticks -325640 102662 342 19.42 882 1771 5.3 97.1 19.6% 0.0% 0.0% 0.0% 62.45sec 102662 300.99sec
NightFae_Niya NightFae_Niya summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
NightFae_Niya NightFae_Niya summon_infernal 1122 23992 80 1.20 3348 6696 2.0 6.0 19.4% 0.0% 0.0% 0.0% 180.75sec 23992 300.99sec
NightFae_Niya NightFae_Niya_infernal immolation 20153 213328 3555 117.00 1529 3059 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.50sec 213328 60.00sec
NightFae_Niya NightFae_Niya_infernal melee 0 15914 265 41.00 326 651 41.0 41.0 19.2% 0.0% 0.0% 0.0% 5.26sec 22731 60.00sec
NightFae_Niya NightFae_Niya_imp firebolt 3110 154878 515 18.52 1395 2790 93.6 92.9 19.5% 0.0% 0.0% 0.0% 3.21sec 154878 300.99sec
NightFae_Niya_burs NightFae_Niya_burs cataclysm 152108 240233 798 5.82 6889 13776 9.7 29.2 19.5% 0.0% 0.0% 0.0% 32.36sec 240233 300.99sec
NightFae_Niya_burs NightFae_Niya_burs channel_demonfire 196447 0 0 0.00 0 0 12.1 0.0 0.0% 0.0% 0.0% 0.0% 25.79sec 0 300.99sec
NightFae_Niya_burs NightFae_Niya_burs channel_demonfire_tick 196448 321155 1067 108.20 496 994 0.0 542.8 19.2% 0.0% 0.0% 0.0% 0.00sec 321155 300.99sec
NightFae_Niya_burs NightFae_Niya_burs chaos_bolt 116858 408389 1357 8.61 0 9452 21.7 43.2 100.0% 0.0% 0.0% 0.0% 13.40sec 408389 300.99sec
NightFae_Niya_burs NightFae_Niya_burs internal_combustion 266134 140630 467 8.54 2744 5488 42.9 42.9 19.6% 0.0% 0.0% 0.0% 13.40sec 140630 300.99sec
NightFae_Niya_burs NightFae_Niya_burs conflagrate 17962 253321 842 11.32 3742 7480 37.1 56.8 19.2% 0.0% 0.0% 0.0% 7.95sec 253321 300.99sec
NightFae_Niya_burs NightFae_Niya_burs havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.03sec 0 300.99sec
NightFae_Niya_burs NightFae_Niya_burs immolate 348 64749 215 6.78 1596 3195 26.7 34.0 19.2% 0.0% 0.0% 0.0% 10.73sec 503561 300.99sec
NightFae_Niya_burs NightFae_Niya_burs immolate ticks -348 438813 1463 69.71 1056 2113 26.7 348.5 19.2% 0.0% 0.0% 0.0% 10.73sec 503561 300.99sec
NightFae_Niya_burs NightFae_Niya_burs incinerate 29722 192415 639 11.07 2899 5809 44.9 55.5 19.5% 0.0% 0.0% 0.0% 6.15sec 192415 300.99sec
NightFae_Niya_burs NightFae_Niya_burs rain_of_fire ticks -5740 285436 951 0.00 576 1152 17.5 0.0 19.2% 0.0% 0.0% 0.0% 16.37sec 285436 300.99sec
NightFae_Niya_burs NightFae_Niya_burs soul_fire 6353 157225 522 1.56 16838 33868 5.6 7.8 18.9% 0.0% 0.0% 0.0% 49.36sec 157225 300.99sec
NightFae_Niya_burs NightFae_Niya_burs soul_rot ticks -325640 102293 341 19.43 883 1764 5.3 97.1 19.3% 0.0% 0.0% 0.0% 62.53sec 102293 300.99sec
NightFae_Niya_burs NightFae_Niya_burs spiked_burrs 333526 0 0 1.89 0 0 9.5 9.5 0.0% 100.0% 0.0% 0.0% 27.65sec 0 300.99sec
NightFae_Niya_burs NightFae_Niya_burs summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
NightFae_Niya_burs NightFae_Niya_burs summon_infernal 1122 24169 80 1.20 3348 6696 2.0 6.0 20.3% 0.0% 0.0% 0.0% 180.58sec 24169 300.99sec
NightFae_Niya_burs NightFae_Niya_burs_infernal immolation 20153 195148 3252 117.00 1395 2790 39.0 117.0 19.6% 0.0% 0.0% 0.0% 5.49sec 195148 60.00sec
NightFae_Niya_burs NightFae_Niya_burs_infernal melee 0 15920 265 41.00 326 651 41.0 41.0 19.3% 0.0% 0.0% 0.0% 5.25sec 22740 60.00sec
NightFae_Niya_burs NightFae_Niya_burs_imp firebolt 3110 154789 514 18.52 1395 2790 93.6 92.9 19.4% 0.0% 0.0% 0.0% 3.21sec 154789 300.99sec
Venthyr_Draven_War Venthyr_Draven_War cataclysm 152108 241205 801 5.80 6944 13894 9.7 29.1 19.4% 0.0% 0.0% 0.0% 32.40sec 241205 300.99sec
Venthyr_Draven_War Venthyr_Draven_War channel_demonfire 196447 0 0 0.00 0 0 12.3 0.0 0.0% 0.0% 0.0% 0.0% 25.49sec 0 300.99sec
Venthyr_Draven_War Venthyr_Draven_War channel_demonfire_tick 196448 320666 1065 109.60 488 977 0.0 549.8 19.4% 0.0% 0.0% 0.0% 0.00sec 320666 300.99sec
Venthyr_Draven_War Venthyr_Draven_War chaos_bolt 116858 425443 1413 9.03 0 9388 22.8 45.3 100.0% 0.0% 0.0% 0.0% 12.78sec 425443 300.99sec
Venthyr_Draven_War Venthyr_Draven_War internal_combustion 266134 146038 485 8.96 2730 5473 44.9 44.9 19.0% 0.0% 0.0% 0.0% 12.80sec 146038 300.99sec
Venthyr_Draven_War Venthyr_Draven_War conflagrate 17962 249794 830 11.15 3762 7504 37.2 56.0 18.8% 0.0% 0.0% 0.0% 7.95sec 249794 300.99sec
Venthyr_Draven_War Venthyr_Draven_War havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.18sec 0 300.99sec
Venthyr_Draven_War Venthyr_Draven_War immolate 348 67150 223 7.02 1600 3200 28.2 35.2 19.2% 0.0% 0.0% 0.0% 10.25sec 502546 300.99sec
Venthyr_Draven_War Venthyr_Draven_War immolate ticks -348 435397 1451 69.42 1052 2104 28.2 347.1 19.2% 0.0% 0.0% 0.0% 10.25sec 502546 300.99sec
Venthyr_Draven_War Venthyr_Draven_War impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.64sec 0 300.99sec
Venthyr_Draven_War Venthyr_Draven_War impending_catastrophe_impact 322167 9713 32 2.78 580 1161 0.0 14.0 19.9% 0.0% 0.0% 0.0% 0.00sec 9713 300.99sec
Venthyr_Draven_War Venthyr_Draven_War impending_catastrophe_dot ticks -322170 61299 204 20.42 503 1006 0.0 102.1 19.4% 0.0% 0.0% 0.0% 0.00sec 61299 300.99sec
Venthyr_Draven_War Venthyr_Draven_War incinerate 29722 180837 601 10.49 2879 5769 41.9 52.6 19.3% 0.0% 0.0% 0.0% 6.59sec 180837 300.99sec
Venthyr_Draven_War Venthyr_Draven_War rain_of_fire ticks -5740 266463 888 0.00 575 1151 16.4 0.0 19.4% 0.0% 0.0% 0.0% 17.71sec 266463 300.99sec
Venthyr_Draven_War Venthyr_Draven_War soul_fire 6353 158072 525 1.51 17389 34476 5.6 7.6 20.6% 0.0% 0.0% 0.0% 49.39sec 158072 300.99sec
Venthyr_Draven_War Venthyr_Draven_War summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
Venthyr_Draven_War Venthyr_Draven_War summon_infernal 1122 24695 82 1.20 3432 6865 2.0 6.0 19.9% 0.0% 0.0% 0.0% 180.56sec 24695 300.99sec
Venthyr_Draven_War Venthyr_Draven_War_infernal immolation 20153 202188 3370 117.00 1448 2895 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.49sec 202188 60.00sec
Venthyr_Draven_War Venthyr_Draven_War_infernal melee 0 16418 274 41.00 338 675 41.0 41.0 18.6% 0.0% 0.0% 0.0% 5.25sec 23451 60.00sec
Venthyr_Draven_War Venthyr_Draven_War_imp firebolt 3110 160545 533 18.52 1448 2896 93.6 92.9 19.4% 0.0% 0.0% 0.0% 3.21sec 160545 300.99sec
Venthyr_Nadjia Venthyr_Nadjia cataclysm 152108 233880 777 5.83 6705 13428 9.7 29.2 19.3% 0.0% 0.0% 0.0% 32.33sec 233880 300.99sec
Venthyr_Nadjia Venthyr_Nadjia channel_demonfire 196447 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 23.70sec 0 300.99sec
Venthyr_Nadjia Venthyr_Nadjia channel_demonfire_tick 196448 325551 1082 115.49 471 942 0.0 579.3 19.3% 0.0% 0.0% 0.0% 0.00sec 325551 300.99sec
Venthyr_Nadjia Venthyr_Nadjia chaos_bolt 116858 409798 1362 9.05 0 9030 22.8 45.4 100.0% 0.0% 0.0% 0.0% 12.68sec 409798 300.99sec
Venthyr_Nadjia Venthyr_Nadjia internal_combustion 266134 144100 479 8.94 2695 5386 44.9 44.9 19.2% 0.0% 0.0% 0.0% 12.63sec 144100 300.99sec
Venthyr_Nadjia Venthyr_Nadjia conflagrate 17962 247075 821 11.34 3643 7252 38.0 56.9 19.4% 0.0% 0.0% 0.0% 7.78sec 247075 300.99sec
Venthyr_Nadjia Venthyr_Nadjia havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.29sec 0 300.99sec
Venthyr_Nadjia Venthyr_Nadjia immolate 348 65505 218 7.12 1540 3068 28.3 35.7 19.3% 0.0% 0.0% 0.0% 10.19sec 497058 300.99sec
Venthyr_Nadjia Venthyr_Nadjia immolate ticks -348 431553 1439 71.43 1012 2026 28.3 357.1 19.3% 0.0% 0.0% 0.0% 10.19sec 497058 300.99sec
Venthyr_Nadjia Venthyr_Nadjia impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.76sec 0 300.99sec
Venthyr_Nadjia Venthyr_Nadjia impending_catastrophe_impact 322167 9291 31 2.78 558 1116 0.0 13.9 19.4% 0.0% 0.0% 0.0% 0.00sec 9291 300.99sec
Venthyr_Nadjia Venthyr_Nadjia impending_catastrophe_dot ticks -322170 60465 202 21.31 476 952 0.0 106.5 19.3% 0.0% 0.0% 0.0% 0.00sec 60465 300.99sec
Venthyr_Nadjia Venthyr_Nadjia incinerate 29722 180205 599 10.84 2773 5580 43.4 54.4 19.3% 0.0% 0.0% 0.0% 6.41sec 180205 300.99sec
Venthyr_Nadjia Venthyr_Nadjia rain_of_fire ticks -5740 267857 893 0.00 553 1105 17.1 0.0 19.3% 0.0% 0.0% 0.0% 17.14sec 267857 300.99sec
Venthyr_Nadjia Venthyr_Nadjia soul_fire 6353 154946 515 1.54 16847 33788 5.6 7.7 19.2% 0.0% 0.0% 0.0% 49.72sec 154946 300.99sec
Venthyr_Nadjia Venthyr_Nadjia summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
Venthyr_Nadjia Venthyr_Nadjia summon_infernal 1122 23779 79 1.20 3348 6696 2.0 6.0 18.4% 0.0% 0.0% 0.0% 180.95sec 23779 300.99sec
Venthyr_Nadjia Venthyr_Nadjia_infernal immolation 20153 213837 3564 117.00 1529 3059 39.0 117.0 19.5% 0.0% 0.0% 0.0% 5.50sec 213837 60.00sec
Venthyr_Nadjia Venthyr_Nadjia_infernal melee 0 15914 265 41.00 326 651 41.0 41.0 19.2% 0.0% 0.0% 0.0% 5.26sec 22731 60.00sec
Venthyr_Nadjia Venthyr_Nadjia_imp firebolt 3110 157448 523 18.90 1395 2790 95.5 94.8 19.1% 0.0% 0.0% 0.0% 3.15sec 157448 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD cataclysm 152108 236523 786 5.82 6771 13558 9.7 29.2 19.6% 0.0% 0.0% 0.0% 32.36sec 236523 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD channel_demonfire 196447 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 24.01sec 0 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD channel_demonfire_tick 196448 328500 1091 115.39 476 951 0.0 578.9 19.3% 0.0% 0.0% 0.0% 0.00sec 328500 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD chaos_bolt 116858 416036 1382 9.01 0 9207 22.7 45.2 100.0% 0.0% 0.0% 0.0% 13.02sec 416036 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD internal_combustion 266134 148137 492 8.90 2781 5554 44.7 44.7 19.3% 0.0% 0.0% 0.0% 13.03sec 148137 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD conflagrate 17962 252710 840 11.35 3728 7399 38.0 56.9 19.3% 0.0% 0.0% 0.0% 7.77sec 252710 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.23sec 0 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD immolate 348 65793 219 7.09 1556 3126 28.2 35.6 18.6% 0.0% 0.0% 0.0% 10.31sec 501889 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD immolate ticks -348 436097 1454 71.42 1024 2047 28.2 357.1 19.3% 0.0% 0.0% 0.0% 10.31sec 501889 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.76sec 0 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD impending_catastrophe_impact 322167 9405 31 2.78 564 1127 0.0 13.9 19.9% 0.0% 0.0% 0.0% 0.00sec 9405 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD impending_catastrophe_dot ticks -322170 61222 204 21.34 480 960 0.0 106.7 19.5% 0.0% 0.0% 0.0% 0.00sec 61222 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD incinerate 29722 185812 617 10.91 2846 5709 43.6 54.7 19.1% 0.0% 0.0% 0.0% 6.25sec 185812 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD rain_of_fire ticks -5740 272156 907 0.00 558 1117 17.2 0.0 19.3% 0.0% 0.0% 0.0% 16.53sec 272156 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD soul_fire 6353 158373 526 1.54 17292 34094 5.6 7.7 19.2% 0.0% 0.0% 0.0% 49.68sec 158373 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD summon_infernal 1122 24103 80 1.20 3382 6763 2.0 6.0 18.8% 0.0% 0.0% 0.0% 180.94sec 24103 300.99sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD_infernal immolation 20153 196819 3280 117.00 1409 2818 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.50sec 196819 60.00sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD_infernal melee 0 16410 273 41.00 335 671 41.0 41.0 19.4% 0.0% 0.0% 0.0% 5.26sec 23440 60.00sec
Venthyr_Nadjia_DD Venthyr_Nadjia_DD_imp firebolt 3110 162455 540 18.90 1437 2874 95.5 94.8 19.3% 0.0% 0.0% 0.0% 3.15sec 162455 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep cataclysm 152108 234259 778 5.83 6704 13410 9.7 29.2 19.5% 0.0% 0.0% 0.0% 32.41sec 234259 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep channel_demonfire 196447 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 24.07sec 0 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep channel_demonfire_tick 196448 325761 1082 115.69 471 941 0.0 580.3 19.3% 0.0% 0.0% 0.0% 0.00sec 325761 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep chaos_bolt 116858 408928 1359 9.03 0 9031 22.8 45.3 100.0% 0.0% 0.0% 0.0% 12.83sec 408928 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep internal_combustion 266134 143643 477 8.92 2695 5370 44.8 44.8 19.2% 0.0% 0.0% 0.0% 12.80sec 143643 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep conflagrate 17962 247241 821 11.33 3640 7270 38.0 56.8 19.6% 0.0% 0.0% 0.0% 7.79sec 247241 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep havoc 80240 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.31sec 0 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep immolate 348 65716 218 7.12 1538 3065 28.2 35.7 19.9% 0.0% 0.0% 0.0% 10.26sec 497338 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep immolate ticks -348 431622 1439 71.45 1012 2027 28.2 357.2 19.3% 0.0% 0.0% 0.0% 10.26sec 497338 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.93sec 0 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep impending_catastrophe_impact 322167 9225 31 2.77 558 1116 0.0 13.9 19.0% 0.0% 0.0% 0.0% 0.00sec 9225 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep impending_catastrophe_dot ticks -322170 60479 202 21.30 476 951 0.0 106.5 19.3% 0.0% 0.0% 0.0% 0.00sec 60479 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep incinerate 29722 181637 603 10.93 2769 5564 43.6 54.8 19.5% 0.0% 0.0% 0.0% 6.29sec 181637 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep rain_of_fire ticks -5740 269050 897 0.00 553 1106 17.2 0.0 19.4% 0.0% 0.0% 0.0% 16.82sec 269050 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep soul_fire 6353 154399 513 1.53 16902 33990 5.6 7.7 19.1% 0.0% 0.0% 0.0% 49.56sec 154399 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep summon_infernal 1122 23837 79 1.20 3348 6696 2.0 6.0 18.7% 0.0% 0.0% 0.0% 180.75sec 23837 300.99sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep_infernal immolation 20153 194623 3244 117.00 1395 2790 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.50sec 194623 60.00sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep_infernal melee 0 15919 265 41.00 326 651 41.0 41.0 19.3% 0.0% 0.0% 0.0% 5.26sec 22738 60.00sec
Venthyr_Nadjia_Prep Venthyr_Nadjia_Prep_imp firebolt 3110 157693 524 18.90 1395 2790 95.5 94.8 19.2% 0.0% 0.0% 0.0% 3.15sec 157693 300.99sec
Venthyr_Theotar Venthyr_Theotar cataclysm 152108 238403 792 5.79 6881 13752 9.7 29.0 19.3% 0.0% 0.0% 0.0% 32.39sec 238403 300.99sec
Venthyr_Theotar Venthyr_Theotar channel_demonfire 196447 0 0 0.00 0 0 12.3 0.0 0.0% 0.0% 0.0% 0.0% 25.57sec 0 300.99sec
Venthyr_Theotar Venthyr_Theotar channel_demonfire_tick 196448 317359 1054 109.65 483 968 0.0 550.0 19.3% 0.0% 0.0% 0.0% 0.00sec 317359 300.99sec
Venthyr_Theotar Venthyr_Theotar chaos_bolt 116858 418540 1391 8.99 0 9282 22.7 45.1 100.0% 0.0% 0.0% 0.0% 12.99sec 418540 300.99sec
Venthyr_Theotar Venthyr_Theotar internal_combustion 266134 144036 479 8.91 2702 5405 44.7 44.7 19.2% 0.0% 0.0% 0.0% 12.93sec 144036 300.99sec
Venthyr_Theotar Venthyr_Theotar conflagrate 17962 248398 825 11.17 3717 7430 37.2 56.0 19.3% 0.0% 0.0% 0.0% 7.95sec 248398 300.99sec
Venthyr_Theotar Venthyr_Theotar havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.22sec 0 300.99sec
Venthyr_Theotar Venthyr_Theotar immolate 348 66576 221 7.02 1583 3149 28.3 35.2 19.6% 0.0% 0.0% 0.0% 10.26sec 497543 300.99sec
Venthyr_Theotar Venthyr_Theotar immolate ticks -348 430967 1437 69.37 1041 2080 28.3 346.8 19.4% 0.0% 0.0% 0.0% 10.26sec 497543 300.99sec
Venthyr_Theotar Venthyr_Theotar impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.45sec 0 300.99sec
Venthyr_Theotar Venthyr_Theotar impending_catastrophe_impact 322167 9314 31 2.79 558 1116 0.0 14.0 19.3% 0.0% 0.0% 0.0% 0.00sec 9314 300.99sec
Venthyr_Theotar Venthyr_Theotar impending_catastrophe_dot ticks -322170 58762 196 20.41 484 967 0.0 102.0 19.1% 0.0% 0.0% 0.0% 0.00sec 58762 300.99sec
Venthyr_Theotar Venthyr_Theotar incinerate 29722 178062 592 10.50 2848 5678 42.0 52.7 18.8% 0.0% 0.0% 0.0% 6.51sec 178062 300.99sec
Venthyr_Theotar Venthyr_Theotar rain_of_fire ticks -5740 263979 880 0.00 568 1137 16.4 0.0 19.3% 0.0% 0.0% 0.0% 17.33sec 263979 300.99sec
Venthyr_Theotar Venthyr_Theotar soul_fire 6353 156657 520 1.51 17120 34201 5.6 7.6 20.6% 0.0% 0.0% 0.0% 49.56sec 156657 300.99sec
Venthyr_Theotar Venthyr_Theotar summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
Venthyr_Theotar Venthyr_Theotar summon_infernal 1122 24019 80 1.20 3348 6696 2.0 6.0 19.6% 0.0% 0.0% 0.0% 180.48sec 24019 300.99sec
Venthyr_Theotar Venthyr_Theotar_infernal immolation 20153 212757 3546 117.00 1529 3058 39.0 117.0 18.9% 0.0% 0.0% 0.0% 5.49sec 212757 60.00sec
Venthyr_Theotar Venthyr_Theotar_infernal melee 0 15905 265 41.00 326 651 41.0 41.0 19.2% 0.0% 0.0% 0.0% 5.25sec 22718 60.00sec
Venthyr_Theotar Venthyr_Theotar_imp firebolt 3110 154649 514 18.52 1395 2790 93.6 92.9 19.3% 0.0% 0.0% 0.0% 3.21sec 154649 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop cataclysm 152108 243664 810 5.79 7014 14042 9.7 29.0 19.6% 0.0% 0.0% 0.0% 32.46sec 243664 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop channel_demonfire 196447 0 0 0.00 0 0 12.3 0.0 0.0% 0.0% 0.0% 0.0% 25.29sec 0 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop channel_demonfire_tick 196448 318457 1058 109.93 484 968 0.0 551.5 19.2% 0.0% 0.0% 0.0% 0.00sec 318457 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop chaos_bolt 116858 419289 1393 9.02 0 9271 22.7 45.2 100.0% 0.0% 0.0% 0.0% 12.83sec 419289 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop internal_combustion 266134 144718 481 8.95 2700 5387 44.9 44.9 19.6% 0.0% 0.0% 0.0% 12.86sec 144718 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop conflagrate 17962 250075 831 11.15 3754 7481 37.2 55.9 19.3% 0.0% 0.0% 0.0% 7.94sec 250075 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.26sec 0 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop immolate 348 66404 221 7.02 1585 3162 28.2 35.2 19.0% 0.0% 0.0% 0.0% 10.21sec 500815 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop immolate ticks -348 434411 1448 69.45 1048 2098 28.2 347.2 19.3% 0.0% 0.0% 0.0% 10.21sec 500815 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.70sec 0 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop impending_catastrophe_impact 322167 9769 32 2.79 588 1176 0.0 14.0 18.8% 0.0% 0.0% 0.0% 0.00sec 9769 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop impending_catastrophe_dot ticks -322170 60679 202 20.39 498 997 0.0 101.9 19.4% 0.0% 0.0% 0.0% 0.00sec 60679 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop incinerate 29722 180539 600 10.50 2877 5774 41.9 52.7 19.0% 0.0% 0.0% 0.0% 6.59sec 180539 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop rain_of_fire ticks -5740 267140 890 0.00 576 1153 16.4 0.0 19.3% 0.0% 0.0% 0.0% 17.77sec 267140 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop soul_fire 6353 154351 513 1.51 17229 34396 5.6 7.6 18.7% 0.0% 0.0% 0.0% 49.44sec 154351 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop summon_infernal 1122 24238 81 1.20 3348 6696 2.0 6.0 20.7% 0.0% 0.0% 0.0% 180.40sec 24238 300.99sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop_infernal immolation 20153 196547 3276 117.00 1407 2813 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.49sec 196547 60.00sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop_infernal melee 0 16080 268 41.00 328 657 41.0 41.0 19.5% 0.0% 0.0% 0.0% 5.25sec 22969 60.00sec
Venthyr_Theotar_Wprop Venthyr_Theotar_Wprop_imp firebolt 3110 155649 517 18.52 1407 2813 93.6 92.9 19.1% 0.0% 0.0% 0.0% 3.21sec 155649 300.99sec
destruction destruction cataclysm 152108 232245 772 5.80 6699 13427 9.7 29.1 19.1% 0.0% 0.0% 0.0% 32.49sec 232245 300.99sec
destruction destruction channel_demonfire 196447 0 0 0.00 0 0 12.3 0.0 0.0% 0.0% 0.0% 0.0% 25.16sec 0 300.99sec
destruction destruction channel_demonfire_tick 196448 310212 1031 110.16 471 941 0.0 552.6 19.3% 0.0% 0.0% 0.0% 0.00sec 310212 300.99sec
destruction destruction chaos_bolt 116858 376137 1250 8.79 0 8526 22.2 44.1 100.0% 0.0% 0.0% 0.0% 13.24sec 376137 300.99sec
destruction destruction internal_combustion 266134 136714 454 8.69 2631 5280 43.6 43.6 19.1% 0.0% 0.0% 0.0% 13.22sec 136714 300.99sec
destruction destruction conflagrate 17962 242465 806 11.22 3598 7200 37.2 56.3 19.6% 0.0% 0.0% 0.0% 7.93sec 242465 300.99sec
destruction destruction havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.37sec 0 300.99sec
destruction destruction immolate 348 64527 214 7.01 1536 3058 28.1 35.2 19.7% 0.0% 0.0% 0.0% 10.37sec 485188 300.99sec
destruction destruction immolate ticks -348 420661 1402 69.57 1014 2029 28.1 347.9 19.2% 0.0% 0.0% 0.0% 10.37sec 485188 300.99sec
destruction destruction incinerate 29722 182812 607 11.61 2633 5267 47.0 58.2 19.2% 0.0% 0.0% 0.0% 5.87sec 182812 300.99sec
destruction destruction rain_of_fire ticks -5740 268792 896 0.00 553 1106 17.2 0.0 19.5% 0.0% 0.0% 0.0% 16.72sec 268792 300.99sec
destruction destruction soul_fire 6353 153783 511 1.52 16948 34010 5.6 7.6 19.1% 0.0% 0.0% 0.0% 49.60sec 153783 300.99sec
destruction destruction summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.99sec
destruction destruction summon_infernal 1122 23992 80 1.20 3348 6696 2.0 6.0 19.4% 0.0% 0.0% 0.0% 180.55sec 23992 300.99sec
destruction destruction_infernal immolation 20153 194587 3243 117.00 1395 2790 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.49sec 194587 60.00sec
destruction destruction_infernal melee 0 15961 266 41.00 326 651 41.0 41.0 19.6% 0.0% 0.0% 0.0% 5.25sec 22799 60.00sec
destruction destruction_imp firebolt 3110 154473 513 18.52 1395 2790 93.6 92.9 19.2% 0.0% 0.0% 0.0% 3.21sec 154473 300.99sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
83610.2 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 56.8sec 13.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 145.6s

Stack Uptimes

  • Health Decade (0 - 10)_1:14.08%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.6sec 8.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 43.4s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.63%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 29.7sec 9.92% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.9s / 42.7s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.92%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 29.8sec 10.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.3s / 38.3s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.04%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.4sec 11.24% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.1s / 39.6s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.24%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 33.9sec 11.42% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.1s / 41.4s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.42%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 33.7sec 11.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.8s / 42.8s

Stack Uptimes

  • Health Decade (60 - 70)_1:11.34%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 30.5sec 10.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.4s / 43.3s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.28%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 21.8sec 7.35% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.5s / 31.1s

Stack Uptimes

  • Health Decade (80 - 90)_1:7.35%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 24.2sec 5.78% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.7s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:5.78%
infernal: Infernal Brand 2.0 39.0 176.4sec 5.3sec 37.5sec 25.22% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:NightFae_Koraylon_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 185.1s
  • trigger_min/max:1.3s / 155.7s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.03%
  • infernal_brand_2:1.03%
  • infernal_brand_3:1.03%
  • infernal_brand_4:1.03%
  • infernal_brand_5:1.03%
  • infernal_brand_6:1.03%
  • infernal_brand_7:1.03%
  • infernal_brand_8:1.03%
  • infernal_brand_9:1.03%
  • infernal_brand_10:1.03%
  • infernal_brand_11:1.03%
  • infernal_brand_12:1.03%
  • infernal_brand_13:1.03%
  • infernal_brand_14:1.03%
  • infernal_brand_15:10.74%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 176.4sec 5.3sec 37.5sec 25.22% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:NightFae_Niya_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 187.4s
  • trigger_min/max:1.3s / 158.0s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.03%
  • infernal_brand_2:1.03%
  • infernal_brand_3:1.03%
  • infernal_brand_4:1.03%
  • infernal_brand_5:1.03%
  • infernal_brand_6:1.03%
  • infernal_brand_7:1.03%
  • infernal_brand_8:1.03%
  • infernal_brand_9:1.03%
  • infernal_brand_10:1.03%
  • infernal_brand_11:1.03%
  • infernal_brand_12:1.03%
  • infernal_brand_13:1.03%
  • infernal_brand_14:1.03%
  • infernal_brand_15:10.74%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 176.2sec 5.3sec 37.5sec 25.22% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Venthyr_Theotar_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 184.7s
  • trigger_min/max:1.3s / 155.3s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.03%
  • infernal_brand_2:1.03%
  • infernal_brand_3:1.03%
  • infernal_brand_4:1.03%
  • infernal_brand_5:1.03%
  • infernal_brand_6:1.03%
  • infernal_brand_7:1.03%
  • infernal_brand_8:1.03%
  • infernal_brand_9:1.03%
  • infernal_brand_10:1.03%
  • infernal_brand_11:1.03%
  • infernal_brand_12:1.03%
  • infernal_brand_13:1.03%
  • infernal_brand_14:1.03%
  • infernal_brand_15:10.74%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 176.6sec 5.3sec 37.5sec 25.22% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Venthyr_Nadjia_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.8s / 186.2s
  • trigger_min/max:1.3s / 156.9s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.03%
  • infernal_brand_2:1.03%
  • infernal_brand_3:1.03%
  • infernal_brand_4:1.03%
  • infernal_brand_5:1.03%
  • infernal_brand_6:1.03%
  • infernal_brand_7:1.03%
  • infernal_brand_8:1.03%
  • infernal_brand_9:1.03%
  • infernal_brand_10:1.03%
  • infernal_brand_11:1.03%
  • infernal_brand_12:1.03%
  • infernal_brand_13:1.03%
  • infernal_brand_14:1.03%
  • infernal_brand_15:10.74%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 176.3sec 5.3sec 37.5sec 25.22% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Kyrian_Forgelite_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 186.3s
  • trigger_min/max:1.3s / 156.9s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.03%
  • infernal_brand_2:1.03%
  • infernal_brand_3:1.03%
  • infernal_brand_4:1.03%
  • infernal_brand_5:1.03%
  • infernal_brand_6:1.03%
  • infernal_brand_7:1.03%
  • infernal_brand_8:1.03%
  • infernal_brand_9:1.03%
  • infernal_brand_10:1.03%
  • infernal_brand_11:1.03%
  • infernal_brand_12:1.03%
  • infernal_brand_13:1.03%
  • infernal_brand_14:1.03%
  • infernal_brand_15:10.74%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 176.3sec 5.3sec 37.5sec 25.22% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Kyrian_Pelagos_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 186.6s
  • trigger_min/max:1.3s / 157.2s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.03%
  • infernal_brand_2:1.03%
  • infernal_brand_3:1.03%
  • infernal_brand_4:1.03%
  • infernal_brand_5:1.03%
  • infernal_brand_6:1.03%
  • infernal_brand_7:1.03%
  • infernal_brand_8:1.03%
  • infernal_brand_9:1.03%
  • infernal_brand_10:1.03%
  • infernal_brand_11:1.03%
  • infernal_brand_12:1.03%
  • infernal_brand_13:1.03%
  • infernal_brand_14:1.03%
  • infernal_brand_15:10.74%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 176.3sec 5.3sec 37.5sec 25.22% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Kyrian_Kleia_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 184.5s
  • trigger_min/max:1.3s / 155.1s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.03%
  • infernal_brand_2:1.03%
  • infernal_brand_3:1.03%
  • infernal_brand_4:1.03%
  • infernal_brand_5:1.03%
  • infernal_brand_6:1.03%
  • infernal_brand_7:1.03%
  • infernal_brand_8:1.03%
  • infernal_brand_9:1.03%
  • infernal_brand_10:1.03%
  • infernal_brand_11:1.03%
  • infernal_brand_12:1.03%
  • infernal_brand_13:1.03%
  • infernal_brand_14:1.03%
  • infernal_brand_15:10.74%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 176.2sec 5.2sec 37.5sec 25.22% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Necrolord_Emeni_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 182.2s
  • trigger_min/max:1.3s / 152.8s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.03%
  • infernal_brand_2:1.03%
  • infernal_brand_3:1.03%
  • infernal_brand_4:1.03%
  • infernal_brand_5:1.03%
  • infernal_brand_6:1.03%
  • infernal_brand_7:1.03%
  • infernal_brand_8:1.03%
  • infernal_brand_9:1.03%
  • infernal_brand_10:1.03%
  • infernal_brand_11:1.03%
  • infernal_brand_12:1.03%
  • infernal_brand_13:1.03%
  • infernal_brand_14:1.03%
  • infernal_brand_15:10.74%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Conflagrate (roaring_blaze) 19.2 17.9 15.6sec 8.0sec 12.5sec 80.15% 0.00% 17.9 (17.9) 18.5

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 40.2s
  • trigger_min/max:2.1s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.1s

Stack Uptimes

  • roaring_blaze_1:80.15%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.7 19.4 16.0sec 7.7sec 13.0sec 80.64% 0.00% 19.4 (19.4) 17.9

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 48.0s
  • trigger_min/max:2.1s / 26.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.4s

Stack Uptimes

  • roaring_blaze_1:80.64%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.3 17.7 15.5sec 8.0sec 12.4sec 79.36% 0.00% 17.7 (17.7) 18.5

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 47.4s
  • trigger_min/max:2.0s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 42.0s

Stack Uptimes

  • roaring_blaze_1:79.36%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.3 17.7 15.4sec 8.0sec 12.4sec 79.54% 0.00% 17.7 (17.7) 18.5

Buff Details

  • buff initial source:NightFae_Koraylon_FS
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 48.9s
  • trigger_min/max:2.1s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 41.9s

Stack Uptimes

  • roaring_blaze_1:79.54%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.5 17.6 15.4sec 8.0sec 12.3sec 79.54% 0.00% 17.6 (17.6) 18.7

Buff Details

  • buff initial source:NightFae_Niya_burs
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.2s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.4s

Stack Uptimes

  • roaring_blaze_1:79.54%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.4 17.7 15.4sec 8.0sec 12.4sec 79.54% 0.00% 17.7 (17.7) 18.6

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 51.5s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 43.2s

Stack Uptimes

  • roaring_blaze_1:79.54%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.7 18.5 16.0sec 8.0sec 12.9sec 79.87% 0.00% 18.5 (18.5) 17.9

Buff Details

  • buff initial source:Venthyr_Theotar_Wprop
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 52.7s
  • trigger_min/max:1.9s / 23.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 43.2s

Stack Uptimes

  • roaring_blaze_1:79.87%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.7 18.5 16.1sec 8.0sec 12.8sec 79.79% 0.00% 18.5 (18.5) 17.9

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 52.8s
  • trigger_min/max:1.9s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.4s

Stack Uptimes

  • roaring_blaze_1:79.79%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 17.8 20.2 16.9sec 7.8sec 13.8sec 81.37% 0.00% 20.2 (20.2) 16.9

Buff Details

  • buff initial source:Venthyr_Nadjia_DD
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 52.6s
  • trigger_min/max:1.9s / 23.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.1s

Stack Uptimes

  • roaring_blaze_1:81.37%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 17.8 20.2 16.9sec 7.8sec 13.7sec 81.32% 0.00% 20.2 (20.2) 17.0

Buff Details

  • buff initial source:Venthyr_Nadjia_Prep
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 43.1s
  • trigger_min/max:1.9s / 23.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 39.1s

Stack Uptimes

  • roaring_blaze_1:81.32%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 17.8 20.2 16.9sec 7.8sec 13.8sec 81.29% 0.00% 20.2 (20.2) 17.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 43.1s
  • trigger_min/max:1.9s / 23.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.1s

Stack Uptimes

  • roaring_blaze_1:81.29%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.6 18.6 16.1sec 8.0sec 12.9sec 79.86% 0.00% 18.6 (18.6) 17.8

Buff Details

  • buff initial source:Venthyr_Draven_War
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 54.0s
  • trigger_min/max:1.9s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.2s

Stack Uptimes

  • roaring_blaze_1:79.86%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.1 18.9 16.5sec 8.0sec 13.0sec 78.27% 0.00% 18.9 (18.9) 17.3

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.3s
  • trigger_min/max:1.9s / 24.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.7s

Stack Uptimes

  • roaring_blaze_1:78.27%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.2 18.8 16.5sec 8.0sec 13.0sec 78.31% 0.00% 18.8 (18.8) 17.3

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.4s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.6s

Stack Uptimes

  • roaring_blaze_1:78.31%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.1 18.9 16.5sec 8.0sec 13.0sec 78.32% 0.00% 18.9 (18.9) 17.3

Buff Details

  • buff initial source:Kyrian_Kleia_Courage
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.3s
  • trigger_min/max:1.9s / 24.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.5s

Stack Uptimes

  • roaring_blaze_1:78.32%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.2 18.7 16.4sec 8.0sec 12.9sec 78.34% 0.00% 18.7 (18.7) 17.4

Buff Details

  • buff initial source:Kyrian_Kleia
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.4s
  • trigger_min/max:1.9s / 23.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.5s

Stack Uptimes

  • roaring_blaze_1:78.34%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.8 18.0 15.8sec 8.0sec 12.5sec 78.33% 0.00% 18.0 (18.0) 18.1

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.0s
  • trigger_min/max:1.9s / 25.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.2s

Stack Uptimes

  • roaring_blaze_1:78.33%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Adversary

Buff Details

  • buff initial source:Venthyr_Nadjia_DD
  • cooldown name:buff_adversary
  • max_stacks:1
  • base duration:600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:331934
  • name:Adversary
  • tooltip:Taking $w1% more damage from $@auracaster, and dealing ${-$W2}.1% less damage to them.
  • description:{$@spelldesc331584=The first enemy you damage in combat is marked as your Adversary. You deal $331934s1% more damage to them, and they deal $<reduc>% less damage to you. You may only have one Adversary at a time.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
Fluffy_Pillow Damage Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 627
Mean 89770.28
Minimum 86954.93
Maximum 93257.13
Spread ( max - min ) 6302.21
Range [ ( max - min ) / 2 * 100% ] 3.51%
Standard Deviation 1423.4027
5th Percentile 87729.43
95th Percentile 92248.82
( 95th Percentile - 5th Percentile ) 4519.40
Mean Distribution
Standard Deviation 56.8452
95.00% Confidence Interval ( 89658.87 - 89881.69 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 966
0.1 Scale Factor Error with Delta=300 17296
0.05 Scale Factor Error with Delta=300 69183
0.01 Scale Factor Error with Delta=300 1729575
HPS
Fluffy_Pillow Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 44
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 23628236 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
44448.4 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 58.2sec 14.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.0s

Stack Uptimes

  • Health Decade (0 - 10)_1:14.39%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 29.0sec 8.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 46.9s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.95%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 29.6sec 9.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.6s / 47.9s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.91%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 30.0sec 10.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.9s / 35.4s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.09%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.6sec 11.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 41.4s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.64%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 36.6sec 12.32% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.2s / 49.9s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.32%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 34.3sec 11.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.2s / 49.4s

Stack Uptimes

  • Health Decade (60 - 70)_1:11.56%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 28.7sec 9.66% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.3s / 37.9s

Stack Uptimes

  • Health Decade (70 - 80)_1:9.66%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 18.3sec 6.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.1s / 26.1s

Stack Uptimes

  • Health Decade (80 - 90)_1:6.15%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 23.3sec 5.47% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.4s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:5.47%
Havoc 9.6 0.0 32.3sec 32.3sec 11.8sec 37.75% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.7s
  • trigger_min/max:30.0s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.75%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.1sec 32.1sec 11.8sec 37.90% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.6s / 39.4s
  • trigger_min/max:30.0s / 39.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.90%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.0sec 32.1sec 11.8sec 37.96% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.8s / 39.7s
  • trigger_min/max:30.0s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.96%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 31.9sec 32.0sec 11.8sec 37.98% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Koraylon_FS
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 40.1s
  • trigger_min/max:30.0s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.98%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.0sec 32.0sec 11.8sec 37.94% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Niya_burs
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 40.0s
  • trigger_min/max:30.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.94%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 31.9sec 32.0sec 11.8sec 37.97% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.8s / 40.1s
  • trigger_min/max:30.0s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.97%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.2sec 32.3sec 11.8sec 37.85% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Venthyr_Theotar_Wprop
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.7s
  • trigger_min/max:30.0s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s

Stack Uptimes

  • havoc_1:37.85%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.2sec 32.3sec 11.8sec 37.82% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.82%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.2sec 32.2sec 11.8sec 37.88% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Venthyr_Nadjia_DD
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.88%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.2sec 32.3sec 11.8sec 37.85% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Venthyr_Nadjia_Prep
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.5s
  • trigger_min/max:30.0s / 39.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.85%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.2sec 32.2sec 11.8sec 37.84% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.84%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.2sec 32.3sec 11.8sec 37.83% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Venthyr_Draven_War
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.83%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.1sec 32.2sec 11.8sec 37.89% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.89%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.1sec 32.2sec 11.8sec 37.94% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.94%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.1sec 32.2sec 11.8sec 37.92% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Kyrian_Kleia_Courage
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.92%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.1sec 32.2sec 11.8sec 37.92% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Kyrian_Kleia
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.92%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.7 0.0 32.1sec 32.2sec 11.8sec 37.90% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.7s
  • trigger_min/max:30.0s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.90%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Conflagrate (roaring_blaze) 10.4 8.7 29.3sec 15.4sec 11.4sec 39.66% 0.00% 8.7 (8.7) 10.1

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 61.2s
  • trigger_min/max:2.4s / 58.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.3s

Stack Uptimes

  • roaring_blaze_1:39.66%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.6 8.7 28.9sec 15.3sec 11.2sec 39.39% 0.00% 8.7 (8.7) 10.2

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.1s
  • trigger_min/max:2.1s / 40.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.7s

Stack Uptimes

  • roaring_blaze_1:39.39%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.5 9.2 28.9sec 14.9sec 11.7sec 40.99% 0.00% 9.2 (9.2) 10.2

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 41.9s
  • trigger_min/max:2.4s / 41.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.6s

Stack Uptimes

  • roaring_blaze_1:40.99%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.6 9.2 28.8sec 14.9sec 11.7sec 41.25% 0.00% 9.2 (9.2) 10.2

Buff Details

  • buff initial source:NightFae_Koraylon_FS
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.0s
  • trigger_min/max:2.4s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.25%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.6 9.1 28.7sec 14.9sec 11.6sec 41.07% 0.00% 9.1 (9.1) 10.3

Buff Details

  • buff initial source:NightFae_Niya_burs
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.0s
  • trigger_min/max:2.4s / 40.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.07%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.6 9.2 28.8sec 14.9sec 11.7sec 41.05% 0.00% 9.2 (9.2) 10.2

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.0s
  • trigger_min/max:2.4s / 41.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.7s

Stack Uptimes

  • roaring_blaze_1:41.05%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.4 8.4 29.5sec 15.8sec 11.3sec 38.94% 0.00% 8.4 (8.4) 10.0

Buff Details

  • buff initial source:Venthyr_Theotar_Wprop
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 42.2s
  • trigger_min/max:2.4s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.4s

Stack Uptimes

  • roaring_blaze_1:38.94%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.3 8.6 29.7sec 15.7sec 11.4sec 39.02% 0.00% 8.6 (8.6) 9.9

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 42.2s
  • trigger_min/max:2.4s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.4s

Stack Uptimes

  • roaring_blaze_1:39.02%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.7 8.2 28.5sec 15.7sec 11.0sec 39.54% 0.00% 8.2 (8.2) 10.4

Buff Details

  • buff initial source:Venthyr_Nadjia_DD
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 64.9s
  • trigger_min/max:2.4s / 61.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.54%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.7 8.1 28.5sec 15.7sec 11.0sec 39.38% 0.00% 8.1 (8.1) 10.4

Buff Details

  • buff initial source:Venthyr_Nadjia_Prep
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 65.0s
  • trigger_min/max:2.4s / 61.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.38%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.7 8.2 28.5sec 15.6sec 11.1sec 39.47% 0.00% 8.2 (8.2) 10.4

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 64.9s
  • trigger_min/max:2.4s / 61.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.47%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.3 8.5 29.7sec 15.7sec 11.4sec 39.02% 0.00% 8.5 (8.5) 10.0

Buff Details

  • buff initial source:Venthyr_Draven_War
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 61.3s
  • trigger_min/max:2.4s / 58.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 18.4s

Stack Uptimes

  • roaring_blaze_1:39.02%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.1 7.0 27.3sec 16.3sec 10.7sec 39.60% 0.00% 7.0 (7.0) 10.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.1s / 69.5s
  • trigger_min/max:2.4s / 69.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.7s

Stack Uptimes

  • roaring_blaze_1:39.60%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.1 7.0 27.3sec 16.3sec 10.7sec 39.71% 0.00% 7.0 (7.0) 10.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 66.5s
  • trigger_min/max:2.4s / 66.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.71%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.1 7.0 27.3sec 16.3sec 10.7sec 39.74% 0.00% 7.0 (7.0) 10.8

Buff Details

  • buff initial source:Kyrian_Kleia_Courage
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 69.4s
  • trigger_min/max:2.4s / 69.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.74%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.2 6.9 27.1sec 16.3sec 10.7sec 39.65% 0.00% 6.9 (6.9) 10.8

Buff Details

  • buff initial source:Kyrian_Kleia
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 69.6s
  • trigger_min/max:2.4s / 69.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.65%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 12.1 6.5 24.8sec 15.9sec 10.4sec 41.96% 0.00% 6.5 (6.5) 11.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 64.2s
  • trigger_min/max:2.4s / 63.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.2s

Stack Uptimes

  • roaring_blaze_1:41.96%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
enemy2 Damage Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 627
Mean 47671.58
Minimum 45758.78
Maximum 50644.04
Spread ( max - min ) 4885.26
Range [ ( max - min ) / 2 * 100% ] 5.12%
Standard Deviation 1018.5571
5th Percentile 46286.96
95th Percentile 49610.65
( 95th Percentile - 5th Percentile ) 3323.69
Mean Distribution
Standard Deviation 40.6773
95.00% Confidence Interval ( 47591.86 - 47751.31 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1754
0.1 Scale Factor Error with Delta=300 8857
0.05 Scale Factor Error with Delta=300 35426
0.01 Scale Factor Error with Delta=300 885635
HPS
enemy2 Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 44
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 14728104 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
27004.8 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 60.6sec 13.83% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 151.8s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.97%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.7sec 8.58% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 49.6s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.58%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 28.4sec 9.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:2.9s / 49.3s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.50%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 27.6sec 9.30% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:17.8s / 41.7s

Stack Uptimes

  • Health Decade (30 - 40)_1:9.30%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.4sec 11.24% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.6s / 44.2s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.24%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 38.4sec 12.95% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.8s / 49.5s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.95%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.7sec 12.71% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.1s / 48.0s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.71%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 31.5sec 10.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.3s / 49.3s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.63%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 15.2sec 5.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.4s / 23.6s

Stack Uptimes

  • Health Decade (80 - 90)_1:5.11%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 25.2sec 6.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.8s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:6.15%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 627
Mean 300.99
Minimum 240.71
Maximum 359.96
Spread ( max - min ) 119.26
Range [ ( max - min ) / 2 * 100% ] 19.81%
DPS
enemy3 Damage Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 627
Mean 28908.06
Minimum 27538.62
Maximum 30504.83
Spread ( max - min ) 2966.21
Range [ ( max - min ) / 2 * 100% ] 5.13%
Standard Deviation 694.0210
5th Percentile 27891.85
95th Percentile 30079.27
( 95th Percentile - 5th Percentile ) 2187.41
Mean Distribution
Standard Deviation 27.7165
95.00% Confidence Interval ( 28853.73 - 28962.38 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2215
0.1 Scale Factor Error with Delta=300 4112
0.05 Scale Factor Error with Delta=300 16448
0.01 Scale Factor Error with Delta=300 411178
HPS
enemy3 Healing Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 627
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 44
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 7217847 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.